KEGG   Flavobacterium gilvum: EM308_01785Help
Entry
EM308_01785       CDS       T04609                                 

Definition
(GenBank) siroheme synthase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
fgl  Flavobacterium gilvum
Pathway
fgl00860  Porphyrin and chlorophyll metabolism
fgl01100  Metabolic pathways
fgl01110  Biosynthesis of secondary metabolites
fgl01120  Microbial metabolism in diverse environments
Module
fgl_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:fgl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EM308_01785
Enzymes [BR:fgl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     EM308_01785
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     EM308_01785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M Shikimate_DH ThiF
Motif
Other DBs
NCBI-ProteinID: AOW08335
UniProt: A0A085EGE4
Position
complement(416192..416773)
Genome map
AA seq 193 aa AA seqDB search
MERNELYPIFLKLHNINVLIVGGGNVGLEKLSFMLKSSPNANVEVVATKFIPELEALVEK
HPSVKLTQSKFKKKMLKKRNMVIACTDDLEVNKRVYKLARECYLICNIADTPDLCDYYLG
GIVTKGNVKIAISTNGKSPTTAKRLREFFEEVIPEDINKMVENLNEYRKTLKGNFEEKVQ
RMNEITKGLKNNE
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaaacgaattatacccaatttttttaaaactgcataacatcaatgtacttatt
gttggtggtggcaatgtaggtttggaaaagttgtcgtttatgttgaaatccagtccaaat
gccaatgttgaggtagtggcgacaaagttcattcctgagttggaagcattagtcgaaaaa
catccttcggtaaaactgacccaatcgaagttcaagaaaaaaatgcttaagaaacgcaat
atggttattgcttgtacagatgatttagaagtcaacaaaagggtgtataaacttgctcga
gagtgttacttgatttgcaatattgccgatacaccagatttatgcgattattatttggga
ggtattgtaaccaaaggaaacgtaaaaattgccatttcgaccaacggaaaatcgcccaca
acagccaaaaggctcagggaatttttcgaagaggtaattccggaagacatcaataaaatg
gtcgaaaacctgaatgaataccgcaaaaccctaaaaggtaattttgaagaaaaagtccaa
aggatgaacgaaattaccaaagggctaaaaaataatgaataa

DBGET integrated database retrieval system