KEGG   Flavobacterium gilvum: EM308_02040Help
Entry
EM308_02040       CDS       T04609                                 

Definition
(GenBank) lipid-A-disaccharide synthase
  KO
K00748  lipid-A-disaccharide synthase [EC:2.4.1.182]
Organism
fgl  Flavobacterium gilvum
Pathway
fgl00540  Lipopolysaccharide biosynthesis
fgl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fgl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    EM308_02040
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:fgl01003]
    EM308_02040
   01005 Lipopolysaccharide biosynthesis proteins [BR:fgl01005]
    EM308_02040
Enzymes [BR:fgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.182  lipid-A-disaccharide synthase
     EM308_02040
Glycosyltransferases [BR:fgl01003]
 Polysaccharide
  Bacterial polysaccharide
   EM308_02040
Lipopolysaccharide biosynthesis proteins [BR:fgl01005]
 Lipid A
  EM308_02040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LpxB PolyA_pol_RNAbd
Motif
Other DBs
NCBI-ProteinID: AOW08382
Position
476305..477417
Genome map
AA seq 370 aa AA seqDB search
MKYYIIAGEASGDLHGSNLMKAIYQEDPNANIRFWGGDLMQNVGGTLVKHYRDLAFMGFI
EVLSNLKTILNNIKICKNDITQFNPDVIIYIDYPGFNMRIAKWAKQVGYKNHYYISPQIW
AWKENRITAIKHDIDKMYVILPFEKDFYEIKHKFLVEFVGHPLIDAIHNQASIDANAFRT
ENHLSEKPIIAILPGSRKQEISKMLSVMLSVVKDFPNYQFVIAGAPSQELSFYQQFISGE
NIKFVSNKTYALLRNATAALVTSGTATLETALFKVPEVVCYKGSWASYQIAKRIITLKYI
SLVNLIMDREVVTELIQDDCSTTRIREELTKILEPNYRKALLENYDLLEEKLGGIGASKK
TAQLIVDAIK
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaaatactatattattgcaggagaagcttcgggggatttgcacggttccaatttaatg
aaagcaatctatcaagaagacccaaatgccaacatccgtttttggggtggcgatttgatg
caaaatgtaggcggaactttggtaaaacactatcgtgatttagcttttatgggttttatc
gaagtgctatccaacctaaaaaccattttaaacaatattaaaatttgcaaaaacgatatc
acgcaattcaatccagatgtaattatttacattgattatcccggtttcaacatgcgaatt
gccaaatgggcgaaacaggttggatacaaaaatcactactatatttcccctcaaatttgg
gcgtggaaagaaaaccgaatcacagctatcaagcacgatattgacaaaatgtatgtgatt
ttgcccttcgaaaaagatttttacgaaatcaaacacaaatttctggttgaatttgttggc
cacccattgattgatgccatccacaaccaagcgagtattgacgccaatgctttcagaacc
gaaaatcatttgtccgaaaaacccattatcgccattttacccggaagccgaaaacaggaa
atcagcaaaatgctgtcggtcatgctaagcgttgtcaaggatttccccaattatcaattt
gtaattgctggagcaccaagtcaggaattatccttttaccaacaattcatttctggcgaa
aacataaaatttgtctccaataaaacctatgctttattgcgcaacgccaccgcagcactg
gtaacctctggaacggccacactcgaaaccgcccttttcaaagtgcccgaagttgtatgc
tacaaaggcagttgggcgtcctatcaaatcgccaagcgaatcatcaccctaaagtacatt
tcgctcgtcaacctaataatggatcgtgaagtcgtaaccgaattaattcaggacgattgt
tcaaccacacgtatccgtgaagaattaaccaaaatcctcgaacccaattaccgcaaagca
ctgcttgaaaactacgatttactcgaagaaaaactaggcggaatcggtgccagcaaaaaa
acagcgcaattgattgttgatgccataaagtag

DBGET integrated database retrieval system