KEGG   Flavobacterium gilvum: EM308_02650Help
Entry
EM308_02650       CDS       T04609                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
fgl  Flavobacterium gilvum
Pathway
fgl00010  Glycolysis / Gluconeogenesis
fgl00020  Citrate cycle (TCA cycle)
fgl00620  Pyruvate metabolism
fgl01100  Metabolic pathways
fgl01110  Biosynthesis of secondary metabolites
fgl01120  Microbial metabolism in diverse environments
fgl01130  Biosynthesis of antibiotics
fgl01200  Carbon metabolism
Module
fgl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EM308_02650
   00020 Citrate cycle (TCA cycle)
    EM308_02650
   00620 Pyruvate metabolism
    EM308_02650
Enzymes [BR:fgl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     EM308_02650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP
Motif
Other DBs
NCBI-ProteinID: AOW08483
UniProt: A0A085EGY9
Position
complement(616019..617620)
Genome map
AA seq 533 aa AA seqDB search
MNNYALFTKSISLKEMGIENAKIHYQLPPAELHEITIQSGQGFENSTGALAVNTGAFTGR
SPQDRFIVKDSITEDKVWWGKINIPFEPTAFEALYKKATAYLSNKEIFVRDSYVCADSNY
RLNIRVVTETAWANLFCYNMFLKPTNEDLENFTPEWTVICVPEFAADPSTDGTRQGNFSI
LDFTRKIALIGGTGYTGEMKKGIFSALNFILPVFKNTLPMHCSANVGQDGDTAIFFGLSG
TGKTTLSADPNRKLIGDDEHGWTNENTVFNFEGGCYAKVVNLTEENEPDIFKAIKKGAIL
ENVVFKTGTNEVDFEDISITPNTRVSYPIEHINNIQPGSIGKNPKNIFFLTADSFGILPP
ISKLTPGQAAYHFISGYTAKVAGTEAGVTEPQPNFSACFGAPFMPLHPTKYAEMLSKKMK
DANVKVWLINTGWTGGPYGTGNRMKLKYTRAMITAALNGQLDDVKFINHEVFGIAIPQSC
PEVPNEILNPRNTWDDKTLYDKKAVELAQKFRDNFSEFSAFANAEILTGAPIA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaacaactacgccttgtttacgaaatcgatttcgttaaaagaaatgggaatcgaaaat
gcaaaaattcattaccagctacccccagccgaattacatgaaattaccatacaatccgga
cagggttttgaaaattctaccggagcattggccgtaaatacgggagcttttacaggtcgt
tctccccaagatcgtttcattgtaaaagacagcatcaccgaggacaaagtgtggtgggga
aaaataaatatcccatttgaaccgaccgcttttgaagcactttataaaaaagctactgct
tatttatccaacaaagaaatttttgtcagggattcttacgtttgtgccgattctaattac
agattaaatattcgtgttgttaccgaaaccgcttgggctaatttattttgctacaatatg
tttttgaaaccgacaaatgaagacttggaaaatttcactccagagtggactgtaatctgc
gttccagaatttgccgcagatccatcaacagatggaacgcgtcaggggaatttctccatt
ttggattttaccagaaaaatagctctgatcggtggtacaggatataccggcgaaatgaaa
aaaggaatcttttcggcgttgaactttattctaccagttttcaaaaacacgcttcctatg
cactgtagtgccaatgtcggtcaagatggggatactgccatattctttggtttatccgga
acaggaaaaactactttgtctgcagacccaaaccgaaaattaatcggtgatgacgaacat
ggttggaccaatgagaataccgtttttaactttgaaggtggctgttatgccaaagtagtc
aacctcaccgaggagaatgaaccggacatttttaaggctatcaaaaaaggagcaattctg
gaaaatgtagttttcaaaaccggaaccaatgaagttgattttgaagatatttccatcacg
ccgaacacaagagtaagttatcctattgagcacatcaataatattcagccaggttccatt
ggcaaaaacccaaaaaatattttcttcttaacagcagattcatttgggattttacctccg
atctcaaaattgactccgggtcaggcggcctatcattttatctcaggatatacagcaaaa
gtggctggaactgaggctggtgttactgagcctcaacccaatttttctgcttgttttgga
gctcctttcatgcctttgcatccaacaaaatatgctgaaatgttgagcaaaaaaatgaaa
gatgccaacgtaaaagtttggttaatcaacaccggatggaccggtgggccttacggaaca
ggaaacagaatgaaattaaaatacacacgagccatgattacggcggcactaaatgggcaa
ttggatgatgtaaaattcatcaatcatgaggtatttggaatcgctattccgcaatcgtgt
ccagaagttccaaatgaaattttaaatccaagaaacacttgggatgacaaaactttgtat
gacaaaaaagctgttgaactggcacaaaaattcagagacaatttttctgaattttcagca
tttgctaatgccgaaattttgaccggtgctcccattgcctga

DBGET integrated database retrieval system