KEGG   Flavobacterium gilvum: EM308_06545Help
Entry
EM308_06545       CDS       T04609                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
fgl  Flavobacterium gilvum
Pathway
fgl00471  D-Glutamine and D-glutamate metabolism
fgl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fgl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    EM308_06545
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fgl01011]
    EM308_06545
Enzymes [BR:fgl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     EM308_06545
Peptidoglycan biosynthesis and degradation proteins [BR:fgl01011]
 Precursor biosynthesis
  Racemase
   EM308_06545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: AOW09192
UniProt: A0A085EJ12
Position
complement(1575756..1576532)
Genome map
AA seq 258 aa AA seqDB search
MTNDRPIGVFDSGIGGTSIWKAIHNLLPNEQTIYLADSKNAPYGQKSKQEIIALSMKNTD
LLIEMGCKLIVVACNTATTNAIQELRAKYSIPFIGIEPAIKPAATNSKTQKIGILATKGT
LNSELFNKTAEKFQDIKIIEQIGHGLVQLIENGQINSTEMTQLLYSYLTPMIEADIDYLV
LGCSHYPYLIPQIKKILPEHIQIIDSGEAVAKQTQNILREKVGFSSAESSNPIFYTNTNP
KVLSEILENKYPVEEMDF
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacgatagaccaattggtgtttttgactcaggaattggaggaacttccatctgg
aaagccattcataatctgttgccaaatgagcaaacgatctaccttgctgacagcaagaat
gctccctatggacaaaaatcaaaacaggaaatcattgccttgagcatgaaaaacactgat
ttattgattgaaatgggatgcaaactgatagttgtggcctgcaatactgcaacaaccaac
gctattcaggaattaagagccaaatacagtattccgtttataggtatagaaccggccata
aaaccggcagcaacaaactctaaaactcaaaaaattggtattctggccacaaaaggaaca
ttaaacagtgagctttttaataaaactgccgagaagtttcaggatatcaaaatcatcgag
caaataggtcacggattggttcagttaatcgaaaacggtcaaatcaattctacagaaatg
acccaattattatattcctatttaacacctatgattgaggccgatattgattatctcgtt
ttgggttgcagtcattatccttatttgattcctcaaataaaaaaaatacttccggaacat
attcaaatcatcgattctggagaggcggttgcaaaacaaacccaaaatatactcagagaa
aaagtaggcttttcgtcagcagaaagtagcaatcctatcttttacacaaacaccaatcca
aaagttttatctgaaatactggaaaacaaatacccggttgaagaaatggatttttaa

DBGET integrated database retrieval system