KEGG   Flavobacterium gilvum: EM308_06810Help
Entry
EM308_06810       CDS       T04609                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
fgl  Flavobacterium gilvum
Brite
KEGG Orthology (KO) [BR:fgl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    EM308_06810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 XhoI DUF4354
Motif
Other DBs
NCBI-ProteinID: AOW09240
UniProt: A0A085ELL6
Position
complement(1628902..1629288)
Genome map
AA seq 128 aa AA seqDB search
MVSQITRGIKITVLTSFEGTYFKNYKIHFAFSYEITIENHSKDSVQLTSRHWEIFDSLND
LEYVDGEGVIGKKPVLKPGEQHTYSSGCLLSSPYGAMKGYFNMINFTSTKSFRVIVPTFR
LCAPFALN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggtttctcaaatcacaagaggcataaaaattacggtattgactagttttgaaggaaca
tacttcaaaaactacaagatacattttgcctttagttatgaaatcaccatcgaaaaccac
agcaaagattctgtacaactcacttctcgtcattgggaaattttcgactccttaaacgat
ttggaatacgttgatggtgaaggcgttattggtaaaaaaccggttttaaaaccaggagaa
caacacacttacagttctggatgcttgctatcatcgccttatggcgccatgaaaggttat
ttcaatatgattaactttacttctactaaatctttcagggttattgtacccacttttaga
ctgtgcgcacctttcgcattaaactaa

DBGET integrated database retrieval system