KEGG   Flavobacterium gilvum: EM308_11120Help
Entry
EM308_11120       CDS       T04609                                 

Definition
(GenBank) tRNA lysidine(34) synthetase TilS
  KO
K04075  tRNA(Ile)-lysidine synthase [EC:6.3.4.19]
Organism
fgl  Flavobacterium gilvum
Brite
KEGG Orthology (KO) [BR:fgl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:fgl03016]
    EM308_11120
Enzymes [BR:fgl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.19  tRNAIle-lysidine synthase
     EM308_11120
Transfer RNA biogenesis [BR:fgl03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    EM308_11120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP_bind_3 TilS_C PAPS_reduct Asn_synthase Endonuc_Holl
Motif
Other DBs
NCBI-ProteinID: AOW10015
UniProt: A0A085EMH1
Position
2672160..2673470
Genome map
AA seq 436 aa AA seqDB search
MKNIIQNHIDKEIPYLKQKKLLLAVSGGLDSMVLLHLFQEMKCDIAIAHCNFQLRGMESF
GDQKFVQDYAEANEIPIFVTQFDTEAFAKDYKFSTQVAARELRYNWFYELLETENFDYIL
TAHHADDNLETFLINLTRGTGLEGLTGIPVQNDRVIRPLLFLSRQEIENYAKANDIQWRE
DSSNASDKYVRNKIRHHLIPVLKELNPHFMSSFLKTEGYLQESLAMVEDAASMVYQQVAI
EEGDQIRFKLKQLLQLPNYQAYLYQWLKEYGFTAWDDIYDLVASQSGKQVFAADYRLLKD
RDSLILSSISNFEENLEFKVDKDNTEVKIPLNMIFSKASTISEASNKAIFVDENQLEFPL
VIRKWKTGDVFHPLGMDGKSKKLSKFFKDEKLSLIEKENTWLLCSNNQIVWVIGLRADHR
FKTLNATKNILKIELI
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacataattcaaaatcatattgacaaagaaattccttatttgaagcaaaaaaaa
ctgcttctcgcagtaagtggtggtttggacagtatggttttattgcatttatttcaggaa
atgaaatgtgatattgccattgcacattgcaattttcagctccggggaatggagagtttt
ggtgaccaaaaatttgtgcaggattatgccgaagccaatgaaattcccatttttgtaacc
cagtttgataccgaggctttcgccaaagattataaattttcgactcaggttgctgctagg
gaattacgatacaattggttttacgagttattggaaaccgaaaattttgattatatactc
accgctcatcacgccgatgacaatcttgaaacttttttgattaaccttacacgaggaaca
ggattggaaggattgactgggattccggtgcaaaatgacagggtgattcgtcccttgctt
tttttgtctcgacaagaaatcgaaaattatgctaaggcaaatgatattcagtggcgggag
gacagtagcaacgcatcggataaatatgttcggaacaaaatacgacatcatttaattccc
gttttgaaggagttgaatccccattttatgagttcatttttgaaaaccgaaggctatttg
caagaatcattggcaatggtcgaggatgccgcatcgatggtttatcagcaagtcgctatt
gaagagggagaccaaattcggtttaaattaaaacaactgttgcaattgcccaattatcag
gcgtatttgtaccaatggctgaaagagtatggttttaccgcttgggatgatatttacgat
ttggtagccagccaatctggtaaacaagtttttgcagcggattatagattgttgaaagac
cgagattctcttattttatcgtctatttcaaatttcgaggaaaatttggaatttaaagtt
gataaagataatacagaagttaagattcccttaaacatgattttttctaaagcatcaacc
atcagtgaagcttcaaataaagctatatttgtagacgaaaatcaattggaatttccgttg
gtaattcgcaagtggaaaactggtgatgtttttcacccacttggaatggatgggaaatcc
aaaaagctgagtaaattttttaaagacgaaaaattatctttgatcgaaaaagaaaataca
tggcttttatgctccaataatcaaattgtttgggtcattggtttaagagccgatcatcgt
tttaaaaccttaaatgcaaccaaaaatatacttaaaattgaattaatttag

DBGET integrated database retrieval system