KEGG   Flavobacterium gilvum: EM308_16790Help
Entry
EM308_16790       CDS       T04609                                 

Definition
(GenBank) hypothetical protein
  KO
K01154  type I restriction enzyme, S subunit [EC:3.1.21.3]
Organism
fgl  Flavobacterium gilvum
Brite
KEGG Orthology (KO) [BR:fgl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:fgl02048]
    EM308_16790
Enzymes [BR:fgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.3  type I site-specific deoxyribonuclease
     EM308_16790
Prokaryotic defense system [BR:fgl02048]
 Restriction and modification system (R-M system)
  Type I R-M system
   EM308_16790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methylase_S CSN8_PSD8_EIF3K
Motif
Other DBs
NCBI-ProteinID: AOW11008
UniProt: A0A085EJ02
Position
complement(4146265..4147563)
Genome map
AA seq 432 aa AA seqDB search
MREGWKEYLLGDLITIKHGYGFKGEFFVDEPNKNLLLTPGNFAIGGGFKSDKMKYYEGPI
SSDFVLSAGDVIVTMTDLSKQADTLGFSARIPNDPKNVYLHNQRIGLVSLKNHDCDLEFI
YWLLRTHSYQRYIAGSSSGATVKHTSPAKIYSAKVQIPKSKVTQRKIASILSAYDDLIEN
NLKRIKLLEEKAQLTYEEWFVKMRFPGHETAKFDEETGLPEGWEKKTIGDVCKVSGGGTP
SRTVDEYWDGGDITWFSPTDLSKANSLCVLDSSQKITEFGLKKSSAKLLDTNSFMMTSRA
TIGLFALINKPFTTNQGFINVTPTNEFDKGFLIYNFKYRVEEFKSHATGATFPELSKSKF
NALDIIWPNEESLKLFSEITSVIHTQLFNLTKQNHLLNEARDILLPRLMSGMIDVEEIQT
TVEEMNITNAEK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgagagagggttggaaagaatacttattaggagatctaattactattaaacatggatat
ggttttaaaggagaattttttgtagatgaacctaataaaaatttattattaacacctgga
aattttgcaatcggtggtgggtttaaaagtgataaaatgaaatattatgaaggccccatt
tcttcagattttgttttatcagcaggtgatgtaatcgtaactatgacagaccttagtaaa
caagccgatacacttggattttcagcaagaattcctaatgacccaaaaaatgtttaccta
cataatcaacgaataggtttagtgtctttaaaaaatcatgattgtgatttagaatttatt
tattggcttttaagaactcattcctatcaaaggtatatagcaggttcttcatcaggtgca
acagtaaaacatacctcaccagctaaaatatattcagctaaagttcaaatccccaaatcc
aaagtaacccaacgcaaaatagcctccatcctatcggcctatgatgatttgatagagaac
aacctcaagcgcatcaaattactggaagaaaaagcccaacttacttatgaagaatggttt
gtaaaaatgcgtttcccgggtcatgaaacggctaagtttgatgaggagacggggttgccg
gaggggtgggagaagaaaacgattggggatgtatgtaaagtttcaggtggaggaactcca
tctagaactgttgatgaatattgggatggtggcgatattacttggttttcacccactgat
ttatccaaagcaaacagcttatgtgttttagatagtagccaaaaaatcacagagtttggt
ttgaagaaaagctctgcaaaacttttagatactaattcatttatgatgaccagtcgagct
actattggattgtttgctttgataaacaaaccgtttacaactaatcaaggatttattaat
gttacaccaacaaatgagtttgataaaggattcctcatatacaattttaagtatagagtt
gaagaatttaaaagtcatgcaactggtgctacttttcctgaattgtccaaaagtaaattt
aatgctttagatattatttggcccaacgaagaatctttaaaactattcagtgaaattaca
tcggtgatacatactcaattgttcaatcttacaaaacaaaaccacctcttgaatgaagcc
cgcgatattttattgccgaggctgatgagcgggatgattgatgtggaggaaatacaaacg
actgtggaggaaatgaatataaccaatgcagaaaaataa

DBGET integrated database retrieval system