KEGG   Fusarium graminearum: FGSG_03132Help
Entry
FGSG_03132        CDS       T01038                                 

Definition
(RefSeq) cell division control protein 2
  KO
K04563  cyclin-dependent kinase [EC:2.7.11.22]
Organism
fgr  Fusarium graminearum
Pathway
fgr04011  MAPK signaling pathway - yeast
fgr04111  Cell cycle - yeast
fgr04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:fgr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    FGSG_03132
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    FGSG_03132
   04113 Meiosis - yeast
    FGSG_03132
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fgr03019]
    FGSG_03132
Enzymes [BR:fgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     FGSG_03132
Messenger RNA biogenesis [BR:fgr03019]
 Eukaryotic Type
  mRNA processing factors
   5' end processing
    Capping factors
     FGSG_03132
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like APH Seadorna_VP7 Kdo
Motif
Other DBs
NCBI-GeneID: 23550461
NCBI-ProteinID: XP_011322636
Position
2
AA seq 328 aa AA seqDB search
MDNYQRIEKVGEGLSQLITHLIHLLTQLSGTYGVVYKARDLGHSGRIVALKKIRLETEDE
GVPSTAIREISVLRELNHANVVSLLNIVHADGHKLYLVMEFLDLDLKKYMDSLPVTDGGR
GKPLPTGTATVIRNLGMSDKVVEKFMLDLCQGIKYCHSRRILHRDLKPQNLLIDKEGNLK
LADFGLARAFGVPLRSYTHEVVTLWYRAPEVLLGGRQYSTGVDMWSVGTIFAEMCSRKPL
FPGDSEIDEIFKIFRTLGTPDEDAWPGVTAYPDFKPSFPKWQRDFSTPLCPNLNEQGLEL
LDYLLICDPVTRISAKAALNHPYFDDIL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggataactaccagagaatagaaaaagtcggagaaggtttgtcccaactcatcactcat
ctcattcacctactaactcaattatcaggtacctatggtgtcgtctacaaagcccgcgac
ttgggccacagcggtcgcatcgtcgccctcaaaaagatccgtctcgagaccgaagacgag
ggtgttcccagcaccgccatccgcgagatttctgtcctgagagagctcaaccatgcaaat
gtcgtcagcctcttgaatattgttcatgcagacggacacaagctctacctcgtcatggaa
tttctcgacctggatctcaaaaagtacatggattccctgcccgttaccgacggaggtcgc
gggaaacccctgcccactggaaccgccactgtcatccgcaatctgggaatgagcgacaag
gtcgtcgaaaagttcatgctcgatttgtgccagggaattaaatactgtcactcgcgtcgc
atattgcatcgcgacttgaagcctcagaacttgcttattgacaaggaaggaaacctcaag
ttggctgattttggtctggctagagcctttggtgttcccttaagaagctatacgcacgag
gttgttactctttggtaccgcgctcccgaggtcttgctcggcggacgacagtattccacc
ggtgtcgatatgtggtccgtcggtaccatctttgccgagatgtgctcccgaaaacctctt
ttccctggcgattccgagattgacgaaatcttcaagatcttccgaactctcggaacaccc
gatgaagacgcatggcccggcgtcactgcctatcctgacttcaagccctctttccccaag
tggcaacgtgacttttccactcctttgtgccccaacttgaacgagcagggcctggagctg
ctcgactacttgctcatctgcgaccccgttactcgtatttctgccaaggcagccctgaac
cacccatactttgacgacattctgtga

DBGET integrated database retrieval system