KEGG   Fusarium graminearum: FGSG_04128Help
Entry
FGSG_04128        CDS       T01038                                 

Definition
(RefSeq) hypothetical protein
  KO
K00877  hydroxymethylpyrimidine/phosphomethylpyrimidine kinase / thiaminase [EC:2.7.1.49 2.7.4.7 3.5.99.2]
Organism
fgr  Fusarium graminearum
Pathway
fgr00730  Thiamine metabolism
fgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fgr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    FGSG_04128
Enzymes [BR:fgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.49  hydroxymethylpyrimidine kinase
     FGSG_04128
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.7  phosphooxymethylpyrimidine kinase
     FGSG_04128
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     FGSG_04128
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phos_pyr_kin TENA_THI-4 PfkB HK
Motif
Other DBs
NCBI-GeneID: 23551392
NCBI-ProteinID: XP_011321508
UniProt: I1RJU6
Position
2
AA seq 510 aa AA seqDB search
MVQGRVLVIAGSDSSGGAGLEADQKVIAAHGCYAMTATTALTAQNTQGVKGIHVIPAEFV
SQQIDACVEDVGVDVIKTGMLASAETIEMVEKTVTKHNIPCLVVDPVMVSTSGATLLPNE
AIQHLCKHLLPHTTVLTPNIPEAVLILSQNGQEAPQVRNVQDLETIAKRIQELGPKWVLV
KGGHSPMKEDLTVAETEVERQFVFDVLVGGNGEVLRVKSPYQASSSTHGTGCSLASAIAS
NLAKGIDTPSAVQSACRYIEAAIRTAPGLGKGHGPLNHFHSTYTLPFAPGYFIEWLLERP
DVRDVWKEFVYHPFVMAMGDGTLPLESFKGYIIQDYLYLIHFSRANALAAYKAQNVEDIS
RATQIVQHIMHELKLHTSYCENFGISLDEMRATPEKQACTAYTRYVLDVGQNGDWLGLQM
ALAPCLLGYGAAAKMLHDHENTVREDNTYWAWIKNYNEEDYTDAVKLGSALLEKHIQLQS
PSRIEELVQIFIHALKMEIGFWEMFPAKQT
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggttcaaggacgagtgcttgttatcgcgggctcggacagttcgggcggagctggactt
gaggcggatcagaaagtcattgctgcccatggctgctatgccatgacggccaccacggcc
ctcactgcgcagaatactcagggcgtcaagggcattcatgtcattcccgccgaatttgtg
tcccaacaaatcgatgcttgtgtagaggatgtaggtgtcgatgtcatcaagacaggcatg
cttgcttcagcagagacaatagagatggttgagaaaactgtcaccaaacacaacatccca
tgtctggttgtagatccagtcatggtttcgacttctggcgcaacactgctccctaacgaa
gctattcaacatctctgcaagcatctcctgccacacaccacagtcctcacaccaaacatt
cccgaggcggtactgattctgtctcaaaatggtcaagaagcccctcaagttcgcaatgtc
caagatcttgaaaccatcgcgaagcgaatccaggagctcggtcccaagtgggtgctcgtc
aagggtggacacagccctatgaaagaggaccttactgtagcagagaccgaggttgagaga
caatttgtctttgatgttcttgttggaggaaatggagaggtcttgagggttaaaagtccg
taccaagcaagctcgagtactcatggcacagggtgctctttggcgtctgctattgcctcg
aacttggccaaaggaattgacacaccctctgctgttcagtcagcgtgtcgatatatcgaa
gctgcgattcgcactgcgccaggactaggtaaggggcatggtcctctaaaccactttcat
tcaacctacactctcccctttgctcccggctactttatcgagtggctccttgaacgcccc
gacgttcgtgatgtctggaaggagtttgtgtaccatccctttgtcatggccatgggagat
ggaactttgcctcttgagtcattcaagggctacattatccaagattacctttatttgatt
cacttctcgcgcgctaacgccctcgccgcctataaagcgcaaaacgtcgaggatatctcc
agagcaacgcaaattgttcagcatatcatgcacgagttgaagctccatacatcctactgt
gagaacttcggcatttcactcgacgagatgcgtgccacgccggagaagcaagcatgcact
gcttatactcgttatgtccttgacgtcggccagaacggagactggctcggtcttcagatg
gccctcgctccatgcctccttggttacggcgcagcggccaagatgctacatgaccacgag
aataccgtacgtgaagacaacacatattgggcttggatcaagaattacaatgaggaagac
tacaccgatgctgtcaagctaggttctgctctactcgagaagcacattcagttgcagtcg
ccttccagaattgaagagctcgttcaaatcttcatccatgcactcaagatggaaatcggc
ttctgggagatgttccctgctaagcagacctaa

DBGET integrated database retrieval system