KEGG   Fusarium graminearum: FGSG_04189Help
Entry
FGSG_04189        CDS       T01038                                 

Definition
(RefSeq) hypothetical protein
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
fgr  Fusarium graminearum
Brite
KEGG Orthology (KO) [BR:fgr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fgr01009]
    FGSG_04189
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     FGSG_04189
Protein phosphatases and associated proteins [BR:fgr01009]
 HAD phosphatases
  Other HAD phosphatases
   FGSG_04189
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-GeneID: 23551451
NCBI-ProteinID: XP_011321439
Position
2
AA seq 307 aa AA seqDB search
MAPRADFPPVRACLFDMDGLLLDTEDIYTKCVNIILEKYGKGTLPWSIKAKLQGRPGPQA
NKIFHDWAQLPITSEEYIAENTALQKELFPQTKPLAGIVDMLGHLGRTRYWEVKDGATKE
KSTTEPHRVHIALATSSHLGNFRVKTNHLEELFAVFPSHRRVLSDHARLTPGRGKPLPNI
YLLALKTINDSLPAGERPITPEECLVFEDSVPGVEAGRRAGMRVIWCPHPMLKKEYDGRE
AEVLAGRTGEAGEVDLHQVGEIDDGWAEYMLSLENFPYEKFGITVPPAEVEKEACMKEVP
EEVVAQV
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggctcctcgtgctgacttcccgcccgtccgggcctgcctcttcgacatggacggtctc
ctcctcgataccgaagatatctacactaagtgtgtcaacatcattctcgagaagtacggc
aagggaaccctcccctggtccatcaaggccaagcttcagggtcgccccggcccccaggcc
aacaagatcttccacgactgggctcagctccccatcacttccgaggaatacatcgccgag
aacactgcccttcagaaggagctgtttccccagaccaagcccctcgccggtattgtcgac
atgctcggtcacctcggccgcacccgatactgggaggtcaaagatggtgctaccaaggag
aagtctaccactgaacctcaccgagttcacattgcccttgctactagctcacaccttggc
aacttccgtgtcaagaccaaccacctggaggagctgtttgccgtctttccttctcatcgt
cgtgtcctcagcgaccacgctcgtctgactcctggacgcgggaagcctctgcccaacatc
tatcttcttgccctgaagacaatcaacgacagtcttcccgccggcgagcgacccatcact
cccgaggagtgtctcgtctttgaagactctgtccccggtgtcgaggctggtcgacgtgcg
ggtatgcgcgtgatctggtgccctcaccccatgctgaagaaggagtacgatgggcgtgag
gctgaggtccttgctggacgcactggcgaggctggagaggtcgacctccaccaagtcggc
gagattgatgacggctgggccgagtatatgctcagcctggaaaactttccctatgagaag
tttggtatcactgttcctcccgccgaggtagagaaggaggcttgcatgaaggaggtcccc
gaggaggttgttgctcaagtctag

DBGET integrated database retrieval system