KEGG   Fusarium graminearum: FGSG_05295Help
Entry
FGSG_05295        CDS       T01038                                 

Definition
(RefSeq) hypothetical protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
fgr  Fusarium graminearum
Pathway
fgr00350  Tyrosine metabolism
fgr00360  Phenylalanine metabolism
fgr00380  Tryptophan metabolism
fgr01100  Metabolic pathways
fgr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fgr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    FGSG_05295
   00360 Phenylalanine metabolism
    FGSG_05295
   00380 Tryptophan metabolism
    FGSG_05295
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    FGSG_05295
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fgr04147]
    FGSG_05295
Enzymes [BR:fgr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     FGSG_05295
    4.1.1.105  L-tryptophan decarboxylase
     FGSG_05295
Exosome [BR:fgr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FGSG_05295
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC PBECR2
Motif
Other DBs
NCBI-GeneID: 23552483
NCBI-ProteinID: XP_011323807
UniProt: I1RMU5
Position
3
AA seq 498 aa AA seqDB search
MEAQEFREAAKAAIDEITDYHENVADHRVVSNVKPGYLRPLLPSAPPKDPEPWSAIHHDI
QSKIFPGITHWSSPRFMAFFPCSTSYPSALAEMYSNAFNGAHFNWICSPAVTELETIVMD
WLAQALGLPECYLSGGSTHGGGVIHGSASEAILTNMCAAREKYLAAVTAHLPDDSEEKED
ALWNHRSKLVALGSSGTHSSTKKAAQVLGIRFATVPITEADGFALKGKALAATIENLRSR
GLEPFFLTATLGTTDVCAVDDFEGIVQALKPTFDTPQEIWVHVDAAYAGSALVLEENHHL
PKAFSSFHSFSFNPHKWLLTTFDCSAVWVRRRAWLIQALSIKPPYLRNQFSDDELVTDYR
DWQIPLGRRFRSLKLWFVMRSFGISGLQKHIRHGVELGDSLETKLASRRDIFTIFTPARF
GLITVRVNGADEREMNDRTEAVYEAINAAGEFYLTATVVNDKFAIRVCTGVAKVEEEHVQ
RMFDILVETAEAEIAKKA
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggaagctcaggaattccgcgaagctgccaaggctgccattgacgagataaccgattat
catgaaaacgtcgccgatcaccgcgtcgtctcaaacgtcaaaccaggctatcttcgtccc
cttctcccctccgctcctcccaaagacccagagccttggtccgccatccatcatgacatc
cagtccaagatcttccccggcataacccattggtcaagccctcgtttcatggccttcttc
ccttgctccaccagctacccttccgctctggctgagatgtactccaacgccttcaacggc
gctcacttcaactggatctgcagtcctgcagtcaccgagcttgagaccattgtcatggac
tggcttgcgcaggcattgggtcttccagagtgctatctcagtggcggctctactcatggc
ggaggtgtcatccatggcagtgccagtgaggctatcctcactaacatgtgtgctgcgagg
gaaaagtacctcgctgctgtcactgctcacctccctgatgatagcgaagagaaggaagat
gccctctggaaccaccgcagcaagcttgtcgctctcggcagttcaggcacacactcgagc
accaagaaagccgctcaggttcttggcatccgcttcgccactgtccccatcaccgaggcc
gatggctttgcgctcaagggcaaggctctggctgctaccatcgaaaacctgcgttctcgt
ggcctcgagccctttttcctgactgccacgcttggcaccactgatgtatgcgccgtcgat
gactttgagggtatcgttcaagctctcaagccaacctttgacacgccccaggaaatctgg
gtgcacgtcgacgctgcctacgcaggctctgcactcgttctcgaggagaaccaccatcta
ccaaaggctttctcgtcgttccactcgttcagcttcaacccccacaagtggcttctcacc
acctttgactgctctgccgtctgggtgcgtcgtcgtgcttggctcatccaagctctcagc
atcaagccaccctatctgcgcaaccaattcagcgatgacgagctcgttactgattaccgc
gactggcaaatccctcttggtcgacgcttccgctctctcaagctatggtttgtcatgcga
agctttggtattagcggtcttcagaagcacattcgccacggcgtcgagcttggcgatagt
ctggagaccaagcttgcctctcgcagagacatttttaccatattcacacctgcgcggttt
ggtctcatcacggtgagggtcaacggcgcagatgaacgtgagatgaatgaccgcactgag
gcggtgtatgaggctatcaacgcggcaggcgagttctaccttacagctactgttgtgaat
gacaagtttgctattcgggtttgtactggtgtggccaaggtagaggaagagcatgttcag
cgcatgtttgacattttggttgagacagccgaggctgagatcgcaaagaaggcataa

DBGET integrated database retrieval system