KEGG   Fusarium graminearum: FGSG_05896Help
Entry
FGSG_05896        CDS       T01038                                 

Definition
(RefSeq) palmitoyltransferase PFA3
  KO
K20028  palmitoyltransferase ZDHHC2/15/20 [EC:2.3.1.225]
Organism
fgr  Fusarium graminearum
Brite
KEGG Orthology (KO) [BR:fgr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fgr04131]
    FGSG_05896
Enzymes [BR:fgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     FGSG_05896
Membrane trafficking [BR:fgr04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    FGSG_05896
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 23553049
NCBI-ProteinID: XP_011324503
UniProt: Q4IA62 A0A1I9FRJ6
Position
3
AA seq 550 aa AA seqDB search
MASARRWARKAERCCCTFATYFPLAFVYGLTSWAVWVVVNIGSVSTKSSWIGTGSSIVGV
ALYVMLNWCYTTAVFTPPGSTTNDMGYGLLPTQNTPQATSFTVKSNGEFRFCKKCQARKP
DRAHHCSTCRRCVLKMDHHCPWLATCIGLRNHKAFLLFLIYTSLFCFWSFAVSACWVWYE
ALNDQEYIDSFLPVNFIMLSVISGIIGLVVGAFTSWHIHLARCGQTTIECLEKTRYLSPL
RKTYNSAHNPANEVPEAARHFVDFHANALPGITRPEEGEERREMPRSYPPDGSQPVQLSY
AQREREQRQRRYEEYLDEQDSEKLPNVFDLGWKRNLLHLFGPTPALWFFPVSNTTGDGWT
WEASSTWLEARDRLSAEREQQRAREVNAGWGSPDDIPDIPERPTGAGKHYSPSPNLAGPK
TMSKADRVLGRDPNLYADATQDVPMQRLSPRGRSIDDELADLDTDDEDGFLDANNPDKAE
GGKFSPSFTSDSHRRDDAEARALEVVTNGNWGRGGASGMLRKGSSQSTPTRTPSNLSRSG
TPKFQDEGVD
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggctcgtaggtgggcgcgcaaagccgagcgttgctgctgtacatttgcgacc
tactttccattggcctttgtatacggcttgacatcatgggctgtttgggtggttgtcaat
atcggtagcgtcagcaccaagagctcttggataggtactggctcttcaatagtaggcgtc
gcactctatgtcatgctcaactggtgctacactaccgctgtctttacacctcccggctcg
acgacaaatgacatgggatatggtcttctaccgacacaaaacacaccccaagccacctcc
ttcacagtcaagagcaacggcgagtttcgattctgcaaaaagtgccaggctcgcaaacct
gatcgtgctcaccactgctcgacatgtcgacgatgcgttctcaagatggaccaccattgc
ccctggctggcgacatgtattggattacgcaaccacaaggccttcctcctcttcctgatt
tatacgtcccttttctgcttctggtctttcgccgtgagtgcatgctgggtctggtatgag
gctctgaacgaccaggaatacattgactccttcctgcccgtcaactttatcatgttgagt
gtcatcagtggaatcattggactcgtggttggcgcttttacatcatggcatattcacttg
gctcgatgtggacagactacgattgagtgtcttgaaaagacaagatacctctcgccgctg
cgtaagacgtacaactctgctcacaaccccgccaatgaagtaccagaggctgctcgccat
tttgtcgactttcacgcaaatgctctacccggtatcacacgtcctgaagaaggcgaggag
cgacgagagatgccccgatcatacccccctgacggttcccagcctgttcaactttcatat
gctcagcgtgagcgggagcagcgacaaaggagatacgaggagtacctcgacgagcaagat
tccgaaaagcttcccaacgtcttcgatcttggctggaaacgcaacttgctgcacctcttt
ggccccacccccgcgctgtggttttttcctgtttccaacactacaggagatggttggaca
tgggaggcaagcagcacatggctagaggctcgcgatcgactctccgctgagcgagaacaa
cagcgagcccgtgaagtgaacgctggctggggttcaccagatgatatccctgacatcccc
gagcgacctacaggcgcaggaaaacattactctcctagcccaaacctcgcaggtcctaag
acaatgagtaaagctgatcgagttcttggccgggaccccaacctatacgctgatgcaaca
caagacgtacctatgcagcgtctcagccctcgtggccgatcaatagacgatgagctagca
gacctggacaccgatgatgaagacggttttcttgacgccaataaccccgacaaagcagaa
ggtggaaagttcagtccaagcttcacatccgactcccatcgtcgagacgatgccgaagcc
cgcgctctagaggtcgttacaaacggcaactggggtcgtggtggtgcgagcggtatgctc
cgcaagggaagctcacagagcactccgaccagaacgcccagcaatctcagccgttcaggg
acacccaagttccaggacgagggcgttgactag

DBGET integrated database retrieval system