KEGG   Fusarium graminearum: FGSG_06606
Entry
FGSG_06606        CDS       T01038                                 

Definition
(RefSeq) Delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
fgr  Fusarium graminearum
Pathway
fgr00100  Steroid biosynthesis
fgr01100  Metabolic pathways
fgr01110  Biosynthesis of secondary metabolites
Module
fgr_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:fgr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    FGSG_06606
Enzymes [BR:fgr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     FGSG_06606
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 23553730
NCBI-ProteinID: XP_011326222
UniProt: I1RR90
Position
4
AA seq 485 aa
MAVKPKQPPAQEQHGYEFFGPPGAFAISFFLPVLVYVFNFVCNDISGCPAPSLLQPKTFS
LDALKQEVGWPHNGVAGLVSWNGTLAVIGYNVLSLILYRVLPAIEVEGTQLSSGGRLKYR
FNTLYSSTFTLAVLAAGTIAQGAEFPVWTFMSENFIQILSANIIYSYLVSTFVYVRSFSV
KHGNKENRELAAGGHSGNILYDWFIGRELNPRIEIPLIGEVDIKEFLELRPGMMGWIIMN
CSWCAQQYRNYGFVTDSSILITAVQALYVFDSWWNEPAILTTMDITTDGFGMMLAFGDIV
WVPYVYSLQTRYLSVHPVSLGPLGLAAMLGLIGLGFYIFRSANNEKNRFRTNPNDPRVSH
LKYIQTKTGSKLLTTGWWGMSRHINYLGDWIQSWPYCLPTGLAGYQIMSAGANIEGAYVM
HDGREVVQGEAQGWGMLITYFYILYFGILLIHRERRDDEKCHRKYGKDWEEYRKIVRSRI
VPGLY
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggccgtcaagccaaaacagcctcctgcgcaagagcagcacggctatgaattctttggc
cctcctggagcttttgccatctcattcttcctccccgttctcgtatacgtcttcaacttt
gtctgcaacgacatctctggctgtccagcgccctctcttctacaacccaagaccttttct
ctcgatgcgctgaagcaagaggttggctggcctcacaatggagttgctggtcttgttagc
tggaacggaacccttgccgtcatcggatacaatgtcttgtctttaatcctctaccgcgtc
ttgcccgctattgaggttgagggaactcagttgagctctggcggtagactcaaataccga
ttcaacaccttgtactctagcacctttactcttgctgtcctcgccgccggaactattgcc
cagggcgccgaattccctgtctggacctttatgtcggagaactttatccagatcctttcc
gccaacattatctactcgtatctcgtttcgacattcgtttacgttcgaagctttagcgtc
aagcatggcaacaaggagaaccgcgagcttgctgccggaggtcactcgggcaacattctg
tatgattggttcattggtcgcgaactgaacccccgtattgagatccctctcatcggtgag
gttgacatcaaggagttcctcgagcttcgacccggcatgatgggctggattatcatgaac
tgctcctggtgcgctcagcaataccgcaactatggctttgtgacggatagctctatcctc
atcaccgctgtccaggctctatatgtctttgactcttggtggaacgaacccgccatcttg
acgacaatggatattaccaccgacggttttggtatgatgcttgctttcggcgacatcgtc
tgggtgccttatgtatactcgctccagacccgatacctctcagttcaccctgtctcgctc
ggtcctctgggtctcgccgcgatgctcggccttatcggtcttggcttttacatcttccgc
tcagccaacaacgagaagaaccgcttccgcaccaacccgaacgaccctagagtctcccac
ctcaagtacatccagaccaagacgggtagcaagttgcttacgactggctggtggggtatg
tcccgacacatcaactaccttggcgattggatccagtcgtggccgtactgccttcccacg
ggcctcgcgggttatcagattatgagcgccggagctaacatcgagggagcgtacgtaatg
cacgatggtcgtgaggtcgtccagggcgaggctcagggatggggcatgttgatcacctac
ttttacatcctgtactttggcattcttcttattcaccgagagcgccgcgacgacgaaaag
tgtcaccgcaagtacggcaaggactgggaggagtatcgcaagattgttcggtctcgaatc
gttcccggcctttactaa

DBGET integrated database retrieval system