KEGG   Fusarium graminearum: FGSG_07075Help
Entry
FGSG_07075        CDS       T01038                                 

Definition
(RefSeq) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
fgr  Fusarium graminearum
Pathway
fgr00020  Citrate cycle (TCA cycle)
fgr00620  Pyruvate metabolism
fgr01100  Metabolic pathways
fgr01200  Carbon metabolism
fgr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FGSG_07075
   00620 Pyruvate metabolism
    FGSG_07075
Enzymes [BR:fgr01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     FGSG_07075
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_C HMGL-like Biotin_carb_N Biotin_lipoyl Biotin_lipoyl_2 Dala_Dala_lig_C zf-C2H2_jaz ATP-grasp zf-met ATP-grasp_3 zf-H2C2_5 HlyD_D23 RimK GARS_A DUF3572 RnfC_N ATP-grasp_4 ATPgrasp_ST zf-C2H2_3rep HlyD_3 DUF2118
Motif
Other DBs
NCBI-GeneID: 23554173
NCBI-ProteinID: XP_011326775
Position
4
AA seq 1552 aa AA seqDB search
MAAIAPQQPLTFNDVFEEEDIDEPKEANSVHHIRANSSIMHVKKILDFQNCRLQFSAHEL
SLHTVAVFRQKADEAYVIGKRGQYTPVGAYLAGDEIVKIAVEHGVQMIHPGYGFLSENAE
FARKVEKAGLIFVGPSPEVIDSLGDKVSARKLANAANVPVVPGTQGAVERYEEVKDFTDK
YGFPIIIKAAFGGGGRGMRVVREQESLKESFERATSEAKTAFGNGTVFVERFLDKPKHIE
VQLLGDNHGNIVHLYERDCSVQRRHQKVVEIAPAKDLPSEVRDNILSDAVRLAKTAGYRN
AGTAEFLVDQQNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGATLNQLGLTQDR
ISTRGFAIQCRITTEDPAKGFQPDTGKIEVYRSSGGNGVRLDTGNGFAGAVITPHYDSML
TKCTCHGSTYEIARRKVLRSLIEFRIRGVRTNIPFLASLLTHPTFIDGTCWTTFIDDTPQ
LFDLVGSQNRAQKLLAYLGDVAVNGSSIKGQIGEPKFKGEIQVPEFINSAGEKVDTSQPC
TKGWRNIILEQGPKAFAKAIREYKGTLLMDTTWRDAHQSLLATRVRTVDLLGIAKETSHA
LSNLYSLECWGGATFDVAMRFLYEDPWDRLRKMRKLVPNIPFQMLLRGANGVAYSSLPDN
AIDHFVDQAKKNGVDIFRVFDALNDIDQLEVGIKAVQRAGGICEGTVSYSGDMLRKTTAD
PSSTLRLGQYRRQELLPFYVKKALDNGFSITHYGLLCWSPIPDLTRAASLRGLFLVLEAA
FTLWFWPIASRTKDYGMPRLFPWDTSTLIHDGCCSHFPLIEGALGLSASLSPEQIAAVKV
ERRRKAQAWFHTQNRAYRRARDRGPVSRRKRRVLASKKFSCITCGLVFDCAFHKRRHEAT
KNHRNKAAGQQFKTVTRWTITYAKNRAAKRYYCQPCDYAAGSRTTLKSHCESKAHLQKAG
DSFSFPSIMRIKGKTAAKRVADRKITAKENVESKKFYCQPCDYATTDRRNFNRHLRAQKH
EDKVTGTVRVPKEPRTEERREQRAAARIAKLHYCEVCDYIAGTQQNLNSHFNTKPHQEKA
KSHQKRPGKKYNLEYYLALVDKLVALDIDILGIKDMAGVLKPHAATLLIGSIREKYPDLP
IHVHTHDSAGTGVASMVACAKAGADAVDAATDSLSGMTSQPSINAIIASLEGSECDPGLD
PKLVRTLDMYWQQLRLLYSPFEAHLAGPDPEVYEHEIPGGQLTNMMFQASQLGLGSQWLE
TKKAYEHANELLGDIVKVTPTSKVVGDLAQFMVSNGLSPEDVKAKASQLDFPSSVLEFLE
GLMGQPYGGFPEPLRSDALRGRRKLDKRPGLFLEPVDFVKTKRELGKKYGAPVTECDVAS
YVMYPKVFEDYKKFVQQYGDLSVLPTRYFLSRPEIGEEFNVELEKGKVLILKLLAVGPLS
ENTGQREVFFEMNGEVRQVTVVDKKAAVENISRPKADANDSSQVGAPMSGVLVELRVHEG
SEVKKGDPIAILSAMKMEMSVSASHSGKVTSLHVREGDSVDGSDLICRIEKA
NT seq 4659 nt NT seq  +upstreamnt  +downstreamnt
atggctgctatcgccccccagcaaccgctcactttcaacgatgtctttgaggaggaggat
attgatgagcccaaggaggccaactcggtccaccacattcgcgccaactctagcatcatg
catgtgaagaagattcttgattttcagaactgtaggttgcaattctcggctcacgagctt
tcactgcacactgttgcagttttcaggcagaaggccgatgaagcctacgtcattggcaag
cgcggacagtacacccctgtcggcgcctatctggctggagatgagattgtcaaaattgcg
gtcgaacatggcgtgcaaatgatccaccccggttacggtttcctctccgagaacgccgaa
tttgcccgcaaggttgagaaggctggcctcatcttcgtcggcccctcccccgaggtcatt
gactcgctcggtgacaaggtctctgcccgaaagcttgccaacgctgccaacgtccctgtt
gttcctggtactcagggcgccgttgaaaggtacgaggaggtcaaggacttcactgacaag
tatggattccccatcatcatcaaggccgctttcggtggtggtggccgtggtatgcgagta
gttcgcgaacaggagagtctcaaggagtcctttgagcgtgccacctccgaggcaaagact
gcctttggtaacggcactgtattcgttgagcgcttccttgacaagcccaagcacattgag
gtccagcttctcggtgacaaccacggcaacatcgtccacttgtacgagcgtgactgctcc
gtccaacgacgacaccaaaaggttgttgagattgctcctgccaaggatcttccctctgaa
gtccgtgacaacattctttccgacgctgtcagactggccaagacagccggctaccgcaat
gcaggcactgcggagttcctggttgaccagcagaaccgtcactactttattgagatcaac
cctcgtattcaggtcgagcacacgatcactgaggagattaccggaattgatatcgttgcc
gcccagattcagattgctgctggtgctactttgaaccagctcggtcttactcaggatcgc
atctcgactcgtggctttgccatccagtgccgtatcacaactgaggatcctgccaagggt
ttccaacctgacactggaaagatcgaggtctaccgatcttctggcggtaacggtgtccgt
ctggataccggtaacggtttcgctggtgccgttatcaccccccattacgactctatgctt
acgaagtgtacttgtcacggctctacctacgaaattgctcgcagaaaggttctccgatcc
ctgatcgagttccgtattcgaggtgtccgaaccaacatccctttcctggcttctcttctc
acccaccctacctttattgatggaacttgctggactactttcatcgacgatacccctcag
cttttcgaccttgttggcagccagaaccgtgcccagaagttgcttgcctacctaggtgac
gttgccgtcaacggcagcagcatcaagggccagatcggtgagcccaagttcaagggcgag
atccaagttcccgagttcatcaactctgccggagagaaggttgatacctcccagccttgc
accaagggatggcgaaacatcatcctcgagcaaggacccaaggcttttgccaaagccatc
cgcgagtacaagggcactctccttatggacacaacttggcgagatgctcaccagtcactt
ctggctactcgtgttcgtacagtcgacttgcttggcatcgccaaagagaccagtcatgct
ctttccaacctctactctcttgagtgctggggaggcgccactttcgatgttgctatgcga
ttcctctatgaggatccttgggaccgacttcgcaagatgcgaaagcttgttcctaacatt
cctttccagatgctgctccgtggtgccaacggcgttgcttactcttctctacctgacaac
gccattgatcacttcgttgaccaggctaagaagaacggtgtcgacatcttccgtgtcttc
gatgctcttaacgatattgatcagctcgaagtcggtatcaaagcggtgcagcgagcaggg
ggtatatgtgagggaacagtatcctactccggagatatgcttagaaagacaactgccgac
ccaagctctacattgagactggggcagtacagaagacaggagttgctgccgttctatgtc
aagaaggccttggacaatggtttctcaatcacccattatggccttctctgctggtcacct
attcctgatctcactcgagcggcttctctgcgtggcctctttttggttcttgaggccgcc
tttactctttggttctggccgatagcatcgcgaactaaagactacggaatgcctcgtctt
ttcccttgggatactagtaccttgatacatgatgggtgctgcagtcacttcccattgatc
gaaggagccttgggtctttccgctagcctttctcctgaacaaattgcagcagtcaaagta
gagaggcggcgcaaggcacaagcttggtttcatactcaaaaccgtgcctacaggagggcc
cgcgacagaggacctgtcagtaggcgcaaacggagggttcttgcttctaagaagttttca
tgcatcacctgtggccttgtattcgactgcgcgtttcataaaaggcgccatgaggctact
aagaatcaccgcaacaaggctgctggccagcagttcaaaacagttactcgctggactatc
acctatgcgaagaaccgcgccgctaaacgatattactgccaaccttgcgactatgctgct
ggaagccgaacaacactcaagagccactgcgagtcaaaggcccatttacaaaaggctggg
gatagcttctcattcccatctatcatgcgcattaagggcaagacagctgcgaagagggta
gccgatagaaagattaccgcaaaggagaatgttgagtcgaaaaagttctattgccaacct
tgcgactatgctacgacagatcggcgcaattttaatcgccaccttagagcgcaaaagcac
gaagacaaagtgactggcactgttcgggtaccgaaagagccgcgcaccgaggagcgcaga
gaacaacgtgccgcagcccgcattgcaaaactacactactgtgaggtctgcgattatatt
gctggaacccagcaaaacctgaacagtcacttcaacacaaagccacaccaggagaaggct
aagtcacatcaaaagcgccctggcaagaagtacaacctcgagtactaccttgctctcgtc
gacaagcttgtcgctcttgacattgatatcctgggtatcaaggacatggctggtgtactg
aagccccatgccgctacactactgatcggatccattcgagaaaagtaccctgatctcccc
atccacgttcatacccatgactcggccggtactggtgttgcctctatggttgcctgcgca
aaggctggcgctgatgctgttgatgccgccaccgacagtctgtcgggaatgacttctcag
cccagcatcaatgctatcattgcttcccttgagggaagcgagtgtgaccctggattggac
cccaagcttgtccgaactcttgacatgtactggcagcaacttcgtctgctctactccccc
ttcgaggcccaccttgctggccccgatcctgaggtgtacgagcacgagattcctggtggt
cagttgaccaacatgatgtttcaagcgtctcagctgggtcttggatcccagtggctcgag
accaagaaggcctatgagcatgccaacgagcttctcggtgacatcgtcaaggttacccca
acttccaaggttgttggtgatcttgctcagttcatggtctccaatggtctttcccccgaa
gatgtcaaggcgaaggcttctcagctcgatttccccagttccgttctggagttccttgag
ggtctgatgggtcaaccttatggtggattccccgagcctcttcgatcagatgctcttcgt
ggtcgacgcaagctcgacaagcgacccggtctgttcctcgagcctgttgacttcgtgaag
accaagcgcgaacttggtaagaagtacggcgcacccgttactgagtgcgacgtcgcttcg
tacgtgatgtaccccaaggtctttgaggactataagaagtttgtccagcaatacggtgat
ctttccgtgctgcccactcgatacttcttgtctcgtcccgagattggcgaggagttcaac
gttgaacttgagaagggcaaggtcttgattctcaagcttcttgctgttggccctctgtcc
gagaacactggacagcgtgaggtcttcttcgagatgaacggagaggttcgacaggtcact
gttgttgacaagaaggctgctgttgaaaacatcagccgacccaaggccgatgctaatgac
tcgagccaggtcggcgcgcctatgtctggtgtcctggtagagctccgcgtccacgagggc
tccgaggttaagaagggagacccaattgcgattctctctgccatgaagatggaaatgagc
gtgagtgcctctcactcgggcaaggtcacatcactccatgtgcgtgagggtgattcggtt
gatggttctgatctcatctgccgaattgaaaaggcataa

DBGET integrated database retrieval system