KEGG   Fusarium graminearum: FGSG_07237Help
Entry
FGSG_07237        CDS       T01038                                 

Definition
(RefSeq) hypothetical protein
  KO
K03254  translation initiation factor 3 subunit A
Organism
fgr  Fusarium graminearum
Pathway
fgr03013  RNA transport
Brite
KEGG Orthology (KO) [BR:fgr00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    FGSG_07237
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:fgr03012]
    FGSG_07237
Translation factors [BR:fgr03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    FGSG_07237
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 23554324
NCBI-ProteinID: XP_011326972
UniProt: I1RSV2
Position
4
AA seq 1057 aa AA seqDB search
MPPPPHQKPENVLKRAHELIGVGQASAALTLLHEHITNKRSRNVPIMSLEPVMLLLVELS
VEQKKGKLAKDALYQYKNISQNTNIATIELVLKKFIELAVEKVTAAQQKADEVQESIDAT
AGTSNIDDLEATETPESILLATVSGEQSRDRTDRAIVTPWLKFLWEAYRTVLDILRNNAR
LEILYQSTATQAFDFCLKYTRKTEFRRLCELLRNHVQTAAKYSSQMHAINLSDPDTLQRH
LETRFQQLNVAVELELWQEAFRSVEDVHTLLNLSKRPPKNVMMANYYEKLTRIFLVGGNH
LFHAAAWSKYYTLLRQSSILVASGQGKKSDNPPVSDAELQKAASFVVLSALAIPVISTSR
SRGAMVDFDEARKNKNSRLTHLLGMSQAPTRARLFRDALSKSLLQRARPEIRELYEILEV
DFHPLSICKKISPILTKIGADSEMEKYILPLQQVILTRLFQQLSQVYETVDLSFVESLAQ
FPEPYQVTRGTIEKFIMNGNKKGDLSVRMAHATGVLSFDNDVFSSSKASHSGSSAGSAES
ETGTVQRLQSTPSEIVRSQLTRLAKSLYTTCHYVDPNFNKNRIEAREAALARAKAGAEEE
HLAILSRKDLIQKRKEVASEIQAKKEKENARQKRLRDQALQEAEDLRLQNEQKEREAKRL
KAERDRVRKEELKKQIADLKMGDKAIDIDLEDLDNLDSNRLRAMKLAQLEREKNDVNERL
RITGKRLDHLERAFRKEESKKLSEDYAKQIEEDRKIYDQMKTQKLQESEQKHKESVELKH
RLSRLVPQYEEFRDSLHERRRDEFEKRRRDAERELEKQITQRKKEVRDRRLREKREREEK
ERELQEAEERAAREKEEQRIRDEARKEELAKLKEQREKERQETLEKAALQQRREDEALAR
RKAEKAQAPAAGFSRAPERTESSEARRPMFGAGKWREREAAREGGDAPPPARAPPVERSD
SNDRPSASGPPRIALAGNKPSWREREAAKQAAGGSGADTGSSAPPPRFAPRGGAPPMDRS
GSGRGEDDRKPSPAPPAESQPASRTAGKWVPPHMRGK
NT seq 3174 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctccgccgcaccaaaagcccgagaatgttctcaagagggcccatgaactcatc
ggtgtcggtcaggcctccgctgccttgaccctgctacatgagcacatcaccaacaagcga
tcccgaaatgtccccatcatgtcgctggagcccgtgatgctcctcctcgtcgagctctcc
gtcgaacagaagaagggcaagcttgccaaggatgctctataccaatacaagaatatttcc
caaaacacaaatattgctaccatcgagttggtcttgaagaagttcatcgagctcgccgtt
gagaaggtcactgccgcccagcaaaaggccgacgaagttcaggagagcattgacgctaca
gccggcacctccaacatcgacgatctcgaggccactgagaccccagagtctattctcctt
gctaccgtctctggcgagcagtcccgagaccgcactgaccgagccatcgtcacaccttgg
ctcaagttcctctgggaggcctaccgaactgtcctcgacatcctccgaaacaacgctcgt
ctcgagattctttaccagagcaccgctacccaggccttcgacttctgcctcaagtacacc
cgcaagaccgagttccgccgtctttgcgagctgctccgcaaccatgtccagaccgccgcc
aagtactcttctcagatgcacgccatcaacctgagcgaccccgacactctgcagcgacat
ctcgagactcgtttccagcagcttaacgtcgctgttgaacttgagctctggcaggaggct
ttccgcagtgttgaggatgtccacactcttcttaacctcagcaagcgacctcctaagaat
gtcatgatggcaaactactacgagaaattgactcgaattttccttgtgggaggcaaccat
ctgttccacgccgctgcttggtccaagtactacactctcctccgccagtcctctattttg
gtcgccagcggccagggcaagaagtctgataacccacctgtgtccgatgccgagcttcag
aaggccgcctcttttgttgtgctctctgctctggccatccccgttatcagcaccagccga
tctcgcggtgccatggttgactttgatgaggctaggaagaacaagaactctcgcctgact
cacctccttggcatgtctcaagctcctactcgtgccagactcttccgtgatgctctgtcc
aagtctctccttcagcgcgcccgtcccgagattcgtgagctctacgagattctcgaggtt
gacttccaccctctctccatttgcaagaagatctcccccattctgaccaagattggtgcc
gattctgagatggagaagtacatcctccctctccagcaggttatcctcacccgcctgttc
cagcagctctcccaggtctacgagactgttgacctttcttttgttgagagtctcgcccag
ttccccgagccctaccaggttactcgtggcaccatcgagaagttcatcatgaacggtaac
aagaagggcgatctgtctgttcgcatggctcacgccactggcgtcttgagctttgacaac
gacgtcttctcttcctccaaggccagccacagtggctcttctgctggctctgccgagtct
gagactggcactgttcagcgtctccagagcaccccctctgagatcgtccgctcgcagctt
acccgccttgccaagtctctttacaccacctgccattacgttgaccccaacttcaacaag
aatcgcatcgaggctcgcgaggctgctctcgctcgcgccaaggctggtgccgaagaggag
cacctcgctatcctctcacgaaaggaccttatccagaagcgcaaggaagttgcttctgag
attcaggccaagaaggagaaggagaatgctcgccagaagagacttcgtgaccaggctctg
caggaggctgaggatctgcgactccaaaatgagcaaaaggagcgtgaggccaagcgactt
aaggccgagcgtgaccgtgtccgtaaggaggagctcaagaagcagatcgccgatctcaag
atgggtgacaaggctatcgatatcgatctggaggaccttgacaaccttgacagcaaccgc
ctacgtgctatgaagcttgcccagttggagcgtgagaagaacgacgttaacgagcgtctc
cgcatcactggtaagcgcctcgatcatcttgaacgtgctttccgtaaggaggaatccaag
aagttgtccgaggattacgccaagcaaattgaggaagatcgcaagatctatgaccaaatg
aagacccagaagcttcaggagtcggagcagaaacataaggagagcgttgagctcaagcac
cgactcagccgactggtgcctcagtatgaggagttccgtgactctctgcatgagcgtcgc
cgtgacgagttcgagaagcgccgccgcgacgctgagcgagaacttgagaagcagatcacc
caacgtaagaaggaggtccgcgaccgacgtctccgcgagaagcgtgagcgcgaggagaag
gagcgtgagcttcaggaggccgaagaacgtgccgcccgcgagaaggaggagcagcgcatc
cgtgatgaggctcgcaaggaagagcttgctaagctcaaggaacagcgagagaaggagcgt
caagagactctcgagaaggctgcccttcagcaacgacgtgaagatgaagcattggcacgt
cgcaaggccgagaaggcccaagcccctgccgctggcttctctcgtgcaccagagcgcaca
gagtcctctgaagccaggagacccatgtttggagctggcaagtggagagagcgtgaggct
gcccgtgagggtggtgatgcacctccgcccgctcgagcacctcctgtcgagaggtccgat
tctaacgaccgaccctctgccagtggtcctcctagaatcgcccttgctggtaacaagccc
agttggcgagagcgcgaggctgccaagcaggcggccggtggtagcggagccgatactgga
tcttccgcgcctccacctcgcttcgcgcccaggggtggtgcgccacctatggaccgaagc
ggctctggccgtggtgaggacgatcgaaagccatctcccgctccaccggcggaatctcag
cctgcatcacgaacagctggcaagtgggttcctcctcacatgaggggtaaataa

DBGET integrated database retrieval system