KEGG   Fusarium graminearum: FGSG_08402Help
Entry
FGSG_08402        CDS       T01038                                 

Definition
(RefSeq) nitrite reductase
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
fgr  Fusarium graminearum
Pathway
fgr00910  Nitrogen metabolism
fgr01100  Metabolic pathways
Module
fgr_M00531  Assimilatory nitrate reduction, nitrate => ammonia
fgr_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:fgr00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    FGSG_08402
Enzymes [BR:fgr01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     FGSG_08402
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 NIR_SIR Pyr_redox Fer2_BFD Rieske Rieske_2 NIR_SIR_ferr Rubredoxin_C K_oxygenase NAD_binding_7 FAD_binding_2
Motif
Other DBs
NCBI-GeneID: 23555410
NCBI-ProteinID: XP_011320374
UniProt: I1RVV7
Position
2
AA seq 1088 aa AA seqDB search
MTATIQKRIVVVGLGMVGIAFIEKLLKYDAKSKEYTITVVGEEPYLAYNRVGLTTFFEHR
KVEELYMNPSEWYLESEASLNYHINTKATHIDTDNKLIECANGESYPYDILVLATGSEAI
LPRTLKGWDSNGVFVYRTIDDLNKLIKFSGDKQGTNGVVVGGGLLGLEAAKAMLDLECYN
KIDLIERSPWVLSRQVDETAGKMVADQVQQLGVNINLGKGVSSLKTDENNNLTGVVFDDD
SEVDCSTLCFAIGVKPRDDLARAANLEVGQRGGIVVNDDLRTSMPDIYAIGECASWRGMA
YGLIGPGVAMAEVVAFNLTQAKLHSPQTFKTPDMSTKLKLLGVNVASFGDCFADRDGPIT
LPRKYAKNLVNGDAKSPKSVQALTYRDPFSNVYKKYIFTKDGKYLLGGMMIGDVCDYVKL
LPMVKSQKELDVSPSELILGAKKGEEDSDDLDDDAQVCSCHNVTKGDIVKVIKDGTCKDI
ASIKKCTKAGTGCGGCVPLVTTIFNKTMASMGQEVTNYLCSHFSYSRADLFNIVMVKRLK
SMNEVMREVGNDKNAVGCELCKPAVASIMASLWNRHVMDKTTHGLQDTNDRFLGNIQRDG
TYSVVPRVSGGEITPDKLVVIGEVAQKYNLYTKITGGQRIDLFGAQKQDLLDIWGQLVAG
GMESGHAYAKSLRTVKSCVGSTWCRFGLSDSVGLAVRLEERYKSIRAPHKIKGGVSGCVR
ECAEAQSKDFGLIATEKGWNIFVGGNGGANPRHAELLAKDVPPTDVVTILDRYLMFYMRT
ADKLQRTARWIENLPGGIKYLQEVILEDKLGINASLEAQMEELVDSFFDEWAEAIKTPAI
ANKFKQFANTSDTTRNMELEDDRGQKRPAFWPNDAAAKDDFQGLKDKWSMTAWEPIIESS
YFDGADELPNGISATIKRGDTQLAIWRIKGVYYATQQMCPHKRAFILSDGLIGQEGHKTE
QNGDKAGAAPWVSCPHHKRNFDLENGACKTDESMSIATFPTEARPDGMLYLKLPPVDELD
SALGTKKWMVKKGEAGEAPLAKLDSKIKFVGIRGKKPYVKPTGQSKMTTKPMDLMMASNG
CGGGAPEW
NT seq 3267 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaacgatacaaaaacgcattgtcgtcgttggactgggcatggttggcattgcc
tttatagagaaactgctcaaatacgatgccaagtcaaaagaatacacaataacagtagtc
ggagaggaaccatatcttgcctacaatcgagtaggactcacaactttcttcgagcaccgc
aaagtcgaagagttatacatgaacccatcagaatggtacctagaatctgaagcctcatta
aattaccatatcaatacaaaagccacacatatcgacactgataacaagcttatcgaatgt
gcaaatggcgagagttacccatacgacatccttgttctcgctacaggctcagaagctatc
ctccctcgcacgttgaaaggatgggatagcaatggagtctttgtataccgtacaatcgat
gacttgaacaagcttatcaagttctctggtgacaagcagggcaccaatggcgttgtcgtg
ggtggtggtctgctcggtctggaagccgccaaggctatgctggatctcgaatgctacaac
aaaatcgatcttattgagagatctccctgggttttgagcagacaggtcgacgagacggcc
ggcaagatggtggcagatcaggttcaacaacttggtgtgaacatcaacttgggcaagggt
gtgtccagtttgaagacagacgaaaacaataaccttactggagtcgtctttgatgatgac
tcggaagttgattgctcgacgctatgctttgctattggtgtcaagcctagagatgacctt
gcaagagcagccaaccttgaggttggccaacgaggcggtattgttgtcaacgacgacttg
aggacaagcatgccagacatctacgccattggagaatgtgctagttggaggggcatggca
tacggtctcatcggccctggtgttgcaatggccgaagtcgttgccttcaaccttacccaa
gccaaactccacagcccccaaaccttcaagactcctgatatgagcaccaagctcaagctg
ttgggagtcaacgtcgcaagttttggtgactgtttcgctgaccgcgatggtcccattacc
cttcctcgcaaatacgcaaagaacctggtcaatggagacgccaagtctcccaagtctgtt
caggcgctcacatacagagatcccttctccaacgtctacaagaaatacatctttaccaag
gatggaaaatatcttctcggcggtatgatgattggcgatgtttgcgactatgttaagctt
ctgcccatggtcaagtctcaaaaggaacttgacgtatctcccagcgagctgatccttggt
gctaagaagggagaggaagactccgatgatcttgacgatgacgctcaggtgtgttcatgc
cacaacgtcaccaaaggcgatatcgttaaggttatcaaagacggcacgtgtaaggatatt
gccagtatcaagaaatgcacaaaggccggtaccggttgtggcggctgcgtgcctctcgtc
accaccatcttcaacaagaccatggcttcgatgggccaagaagttacaaactatctctgt
tcacacttcagctactcacgtgccgacttgttcaacattgtcatggtcaagcgccttaag
tctatgaacgaggtcatgcgtgaggttggaaatgacaagaacgctgttggttgtgagttg
tgcaagcccgcagtggccagcatcatggcttcgctgtggaacagacacgttatggacaag
acgacccacggtcttcaggacacaaacgaccgtttcctgggtaacatccagcgtgatgga
acctactctgtggtgcctcgtgtatccggtggtgaaatcactcccgacaaacttgtcgtc
ataggcgaggttgctcagaagtataacctgtacaccaagatcacaggtggacagcgtatt
gacttgtttggtgcccagaagcaggatctgctggacatctggggtcagcttgtcgctggt
ggtatggagtctggtcacgcttatgccaagtcactacgaactgtcaagagttgtgtaggt
tctacatggtgtcgattcggcctcagtgatagtgttggtctagctgtacgtctggaggag
aggtacaagagtatccgagcccctcacaagatcaaaggtggtgtcagtggctgtgtgcgc
gaatgtgctgaagctcaaagcaaagatttcggtttgatcgctacagaaaagggatggaac
atcttcgttggtggtaacggtggtgcaaacccccgccatgccgagctactagccaaggac
gtgcctccaactgatgtcgttactatcttggaccgctatcttatgttctacatgcgcaca
gccgataagctccagcgaacagcacgctggatcgagaacctccccggaggcatcaagtac
ctccaggaggtcatccttgaggacaagcttggcattaatgcctcacttgaggctcagatg
gaagaactcgttgatagtttcttcgacgagtgggccgaagccatcaagactcctgctatt
gcgaacaagttcaagcagttcgccaacacaagtgatacgacgcgcaacatggagcttgag
gatgaccgtggtcaaaagagacctgccttctggcctaatgatgctgcggcaaaggatgat
ttccagggcctcaaggataagtggtccatgacggcttgggagcccatcattgaatcatca
tactttgacggtgctgacgagttgcccaatggtatctctgccaccatcaagcgtggcgac
actcaactcgccatctggcgtatcaagggtgtctactacgctactcaacaaatgtgccct
cacaaacgtgcattcatcctatcggacggtctcatcggtcaagaaggtcacaaaaccgaa
caaaatggcgacaaggcaggcgctgcaccttgggtctcatgtcctcaccacaagcgcaac
ttcgaccttgaaaacggtgcttgcaaaacagacgagtccatgtccatcgctacattccct
actgaggctcgcccggacggcatgctgtacctcaagcttcccccagtggacgagctcgac
agcgccctaggcaccaagaagtggatggtgaagaagggcgaggctggtgaggcaccgctg
gctaaactagatagcaagatcaagtttgtgggtattcgtggtaagaagccatatgttaag
cctactggccagtccaagatgactaccaagccgatggatctcatgatggcatccaatgga
tgtggaggtggtgcaccggagtggtaa

DBGET integrated database retrieval system