KEGG   Fusarium graminearum: FGSG_09786Help
Entry
FGSG_09786        CDS       T01038                                 

Definition
(RefSeq) NADPH-cytochrome P450 reductase
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
fgr  Fusarium graminearum
Brite
Enzymes [BR:fgr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     FGSG_09786
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1 Flavodoxin_5
Motif
Other DBs
NCBI-GeneID: 23556720
NCBI-ProteinID: XP_011327904
UniProt: I1RZE7
Position
4
AA seq 692 aa AA seqDB search
MAELDTLDVIVLGVIFLGTVAYFTKGKLWGVTKDPYANGFAAGGAAKPGRTRNIVEAMEE
SGKNCVIFYGSQTGTAEDYASRLAKEGKSRFGLNTMIADIEDYDFDSLDTVPNDNVVMFV
LATYGEGEPTDNAVDFYEFITGEDATFNEGNDPPLGNLNYVAFGLGNNTYEHYNAMVRKV
DQALEKFGAHRIGEAGEGDDGAGTMEEDFLAWKDPMWESLAKKMGLEEREAVYEPIFAIN
ERDDLSPESNEVYLGEPNKLHLEGTAKGPFNSHNPYIAPIAESYELFSAKDRNCLHMEVD
ISGSNLKYETGDHIAIWPTNPGEEVNRFLDILDLSGKQHSVITVKALEPTAKVPFPNPTT
YDAILRYHLEICAPVSRQFVSTLAAFAPNDSIKAEMNRLGSDKDYFHEKTGPHYYNIARF
LSSVSKGEKWTTIPFSAFIEGLTKLQPRYYSISSSSLVQPKKISITAVVESQQIPGRDDP
FRGVATNYLFALKQKQNGDPSPAPFGQTYELTGPRNKYDGIHVPVHVRHSNFKLPSDPGK
PVIMIGPGTGVAPFRGFVQERAKLARDGVEVGKTLLFFGCRKPSEDFMYEKEWQEYKEAL
GDKFEMITAFSRESAKKVYVQHRLKERAQEVSDLLSQKAYFYVCGDASNMAREVNTVLAQ
IIAEGRGVSEAKGEEIVKNMRSANQYQEDVWS
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggctgaactagacactctggacgttatcgtcctcggagtcattttccttggaacggtc
gcatacttcacaaaaggaaagctatggggtgttaccaaggacccttatgccaatggcttc
gctgccggcggcgctgccaagcctggtcgcacgagaaacatcgtcgaggccatggaggaa
tctggcaagaactgtgtcatcttctatggttctcagactggtaccgctgaagattatgct
tcccgtctcgccaaggagggtaagagtcgattcggactcaacaccatgatcgccgatatt
gaagactacgatttcgatagcctggatactgtccccaacgacaacgttgtcatgtttgtc
ctcgcaacttacggtgaaggcgagcctaccgacaacgcagtcgatttctacgagttcatc
actggtgaggatgccaccttcaacgagggcaatgacccccctctgggcaacctcaactat
gtcgctttcggtctcggaaacaacacctacgaacactacaacgccatggtccgtaaagtt
gaccaggctcttgagaaatttggtgctcaccgcatcggcgaagctggtgaaggtgacgat
ggcgctggtaccatggaagaggacttcttggcctggaaggatcccatgtgggagtccctt
gctaagaaaatgggactggaagagcgcgaagccgtttacgagcctatctttgccattaac
gagcgtgacgacctgagccccgaatccaacgaagtctatctcggtgaacctaacaagctg
catctcgaaggcactgccaagggtccctttaactctcacaacccctacattgcccctatt
gccgagtcatacgagctcttctctgccaaggacaggaactgccttcacatggaagtcgac
atcagcggttctaacctcaaatacgaaactggtgatcacattgctatctggcccacaaat
cctggtgaggaggttaaccgtttcttggatattctcgatctctccggcaagcagcacagc
gtcatcaccgttaaggctcttgagcctaccgccaaggttcccttccctaaccctacgacc
tacgatgccattctgcgataccatctcgagatctgcgctcctgtttcccgtcaattcgtt
tctactctcgctgctttcgctcccaacgactctatcaaggctgagatgaaccgtctcggt
agcgataaggactacttccacgagaagaccggccctcactactacaatattgctcgtttc
ctctccagtgttagcaagggtgaaaagtggaccacgattcccttctccgccttcatcgag
ggtctcaccaagctccagccccgctattactccatctcctcctcttctctggttcagcct
aagaagatttccatcaccgccgtcgtcgagtcccagcaaattcctggccgagatgaccct
ttccgcggcgtcgctaccaactatctctttgccctgaagcagaagcagaacggcgacccc
agcccagcaccttttggtcagacatacgagcttacaggtccccgcaacaagtacgatggt
atccatgtccccgtccatgttcgtcactccaacttcaagctaccttcggaccctggaaag
cctgtcatcatgattggccctggtactggtgtcgctcctttccgtggtttcgtccaggaa
cgtgccaagttggcccgcgatggtgttgaggtcggaaagactctattgttcttcggttgc
cgaaagcccagtgaagatttcatgtacgagaaggaatggcaggaatacaaggaggctctc
ggcgacaagttcgagatgatcacagccttttctcgagaaagcgccaagaaggtttatgtt
cagcaccgacttaaggagagagcacaagaggtcagcgacctgctctcccagaaggcctac
ttctatgtttgtggtgatgcttcaaacatggctcgcgaggtcaacactgttttggcgcaa
atcattgccgaaggacgtggagtgtctgaggctaagggtgaggagattgtgaagaacatg
agatcggcaaaccaatatcaggaggatgtttggtcataa

DBGET integrated database retrieval system