KEGG   Fusarium graminearum: FGSG_10318Help
Entry
FGSG_10318        CDS       T01038                                 

Definition
(RefSeq) hypothetical protein
  KO
K01426  amidase [EC:3.5.1.4]
Organism
fgr  Fusarium graminearum
Pathway
fgr00330  Arginine and proline metabolism
fgr00360  Phenylalanine metabolism
fgr00380  Tryptophan metabolism
fgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fgr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    FGSG_10318
   00360 Phenylalanine metabolism
    FGSG_10318
   00380 Tryptophan metabolism
    FGSG_10318
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     FGSG_10318
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 23557229
NCBI-ProteinID: XP_011319278
UniProt: I1S0T1
Position
1
AA seq 546 aa AA seqDB search
MTLTTTTTTTAKLDTTPSWKDISTTKIEALNSSIPQEWRIPQDLLPPADQADVTEWPETS
TWFTKDELAITSLTATELIQKLASGTFKSEDVTRAFCKRAAAAHQLTNCLAETCFDRAIQ
TARRLDELFAKTKTPVGPLHGLPISLKDNFNLQGLDATVGFTSHVGDPAESDSGLATLLQ
NAGAVFYVKTNVPTAMMIAESINNTFGRTVNPKNRNTTSGGSSGGESALISFKGSPLGVG
TDIGGSLRIPAACTGIFTIRPSAGRFPVRNCRSGMPGQEAVQSVNGPLARTIQDIQFYSK
TVIDAQPWLADPKCLPIPWRPAQLPDKLKIAFMWHDGLVLPTPPVARALRVAKEKLEAAG
HTIVEWDPVDQKEGGDLLQRMFLADGGQTIRKVLERTDEPWRPEMDGYRTARDLSTSEMW
KLQLERTAFQNKYLDRWNKAGIDAIVCPTTPYSTVKNGTFQHVAYTGVFNVVDYSAVSFP
TGISVDKDVDVLGSSYQPLSPLCKSVNEDYDAALVHGLPVSLQIVARRLEEEKVLAMAEL
VHDTMI
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgactctcaccaccacaaccaccaccacagccaagctcgacactactccctcatggaag
gacattagcaccacaaagatcgaggctctcaattcatccattccccaagaatggcgtatt
ccccaagacctacttcctccagcagaccaagcagatgtcacagaatggccagaaacctca
acatggttcacaaaggatgaactcgcaatcacatccctcactgcaactgaactcattcag
aaactcgcttccggtaccttcaagtctgaagatgtcaccagggcattctgcaagagagca
gcagctgctcaccaacttaccaactgtttagcagagacctgctttgaccgcgctatccaa
acagcacgtcgtctcgatgagctctttgccaaaacaaagacacccgtcggacctctccac
ggtcttcccatctccctcaaagacaacttcaacctacaaggcctcgacgcaaccgtcggc
ttcacatcccacgtcggcgaccctgccgaatccgactctggcttggcaacgctgcttcaa
aatgccggcgctgtcttttacgtcaagacaaatgttcccacggccatgatgattgcggaa
tccatcaacaatacatttggacgaactgtgaaccccaagaacagaaacactaccagtggc
ggaagctccggcggcgagtctgcgcttatttccttcaagggtagtcctttgggtgttgga
accgatataggaggatcgctacgtattcccgctgcctgcactggaatcttcaccatccgt
ccttcagcaggccgtttccccgtccgtaactgccgctcaggaatgcccggccaagaagcc
gtccaatccgtcaacggtcctctcgcccgaaccatccaagacatacaattctacagcaag
actgtgatagacgcacagccctggctcgccgatcccaaatgtctccccatcccctggcga
ccagcccagctgcccgacaagctaaagatcgcgttcatgtggcacgacggtcttgtcctc
ccaacaccgcccgtcgctcgagccctccgagtcgcaaaggagaaactcgaagccgctgga
cacaccatcgtggagtgggatcctgttgaccaaaaggaaggtggggatcttcttcagcgc
atgtttttggcggatggtggacagacgattcgaaaggtactcgagcgaacggatgagccg
tggagacctgagatggacggttatcgaaccgcgagagacttgagtacttctgagatgtgg
aagctccaacttgagcgaactgcgttccagaataagtatttggatcgatggaacaaggcg
ggtatcgatgctatcgtatgcccaacaacgccctacagtactgtaaagaacggaactttt
caacacgttgcttatactggcgtcttcaacgtcgtcgactattccgccgtgtcgttcccg
acaggaatcagcgttgacaaggacgtcgatgtgctgggctcttcataccagcctttgagt
ccgttatgcaaatctgtcaacgaagattatgacgctgcattggtgcacggtctaccagtt
agtcttcagatcgttgcgcgcaggctagaagaagaaaaggttctggccatggccgaactg
gtacatgacaccatgatctga

DBGET integrated database retrieval system