KEGG   Fusarium graminearum: FGSG_11236Help
Entry
FGSG_11236        CDS       T01038                                 

Definition
(RefSeq) hypothetical protein
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
fgr  Fusarium graminearum
Pathway
fgr00562  Inositol phosphate metabolism
fgr00564  Glycerophospholipid metabolism
fgr00565  Ether lipid metabolism
fgr01100  Metabolic pathways
fgr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    FGSG_11236
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    FGSG_11236
   00565 Ether lipid metabolism
    FGSG_11236
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:fgr02042]
    FGSG_11236
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     FGSG_11236
Bacterial toxins [BR:fgr02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   FGSG_11236
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphoesterase Fascin Ntox21
Motif
Other DBs
NCBI-GeneID: 23558093
NCBI-ProteinID: XP_011325099
UniProt: I1S368
Position
3
AA seq 647 aa AA seqDB search
MRQLIESWLLWLYHFTTDWPCSITMLLSRGVGLAIAAFLAAINPAQPASLADIDHVILFM
QENRAFDHYFGTMAGVRGFADPNVQVNDGVPVWKQKVTAKQSQDTDYITPWYLNYLGGTW
PEATQCMGAGSNGWDANQAALNHGANDRWAMNNTPYSMGYYKRQDLPVHFALAEEWTVGD
MYQESVIASTNPNRVMWISGSINVPGSPQTKDEGGYPYIDNNETPGCDKNGINCYPLKWT
TAAEKYEAAGVSWSVFQDADNFDDNPYAWFEQFQDSKSGSKLNEKGMKGQSLDAFFAQAA
SGTLPEVSYIVGPMQLSEHPPYSPHDGSWLQRKVAEAVINSPKYSKSALIISYDETGGWA
DHVTPYHAPDGTAGEWIDDPYGEVGRTPTGPGFRVPFYIISPFTRKGGVYTEHCDHTSQM
TFIERWQAAKGRDVKSEEVVPWRRENMADLVNAFDFKNPDYSIPTLPNAPQPHTNSKGEY
DGSSHCSSQYGSGKPAVPYTGEGANNDTATLAEKGFKPVRGLLTEGRTLVFEASSQALSL
GSNGQVVALSKATKMHDNVKHGWVLHALDIGGDDFTISSAQNSLYMCSNLKLCKDPSSAT
VFTVDFQPSKGHSFMNKESGQYLAGSAKKQLSWQDTQSFWKTFSVTY
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgcggcaattaatcgagtcctggcttctctggctctatcacttcaccactgactggcct
tgttctatcaccatgttactatcacggggcgtaggtcttgccattgcggcttttcttgca
gccataaatccagcacaaccagcgagcctggctgatatcgaccacgtcattttgttcatg
caagagaaccgtgctttcgatcactacttcggcactatggccggagttcgaggctttgcg
gatccaaatgttcaggttaacgacggagttcctgtttggaagcagaaggtcactgcaaag
cagagccaggataccgattacatcactccttggtatctcaactacctcggaggcacgtgg
ccggaagccacccagtgcatgggtgctgggtccaacggctgggatgccaaccaagccgct
ttgaaccatggggccaacgaccgttgggccatgaacaacaccccatatagcatgggttac
tataagcgacaagatcttcctgtccattttgccttggctgaggaatggactgttggcgac
atgtatcaggagtctgtcatcgcttcaaccaacccaaacagagtcatgtggatcagcgga
tccatcaacgtcccaggttctccacagaccaaagacgaaggtggttatccctacatcgac
aacaacgagacacctggttgtgataaaaacggaatcaactgttaccctctcaaatggact
acagctgccgagaagtatgaggctgctggcgtgtcttggagtgtgtttcaagacgccgat
aactttgacgacaatccttatgcatggtttgagcagttccaagactccaagagcgggtct
aagctgaacgaaaaaggaatgaagggacaatccctggatgccttcttcgctcaagctgcc
agcggaacacttcccgaagtctcttacatcgtcggaccaatgcaactatccgaacaccct
ccttactcgccgcatgacggttcatggctgcaaaggaaagttgcagaagctgttatcaat
tctcccaagtactccaaatctgcacttatcatttcctatgatgagacaggcgggtgggca
gatcacgtcaccccttatcacgcccctgatggaacagctggtgaatggatcgatgatccg
tatggtgaagttggtcgcacgcccactggcccaggctttcgcgtgccattctacatcatc
tctccattcactcgcaaaggaggcgtttacactgaacactgtgatcacacgtcccagatg
acctttatcgaaagatggcaggctgcaaagggtcgtgatgtcaagtccgaggaggtagtt
ccctggcgacgggagaacatggccgaccttgtgaatgccttcgacttcaaaaaccctgac
tattccattccaactctccctaatgctcctcagcctcacaccaatagcaagggcgaatac
gacggatcgtcgcattgttcttctcaatatggtagcggtaaaccagctgtgccttatacc
ggtgagggagctaataatgacacggcaactctagcggagaagggcttcaagcctgtccgt
ggactattgacggaggggcgtactctggtctttgaagcttcaagccaggctttgagtttg
gggtccaacggccaagtagttgccctgtccaaagccacaaagatgcatgacaatgtcaag
cacggttgggttcttcatgccttggatattggtggggacgattttactatcagttctgct
cagaacagcttgtatatgtgctctaacttgaaactttgcaaggatcccagctcggctact
gtctttactgtcgacttccagccaagcaaggggcactcgtttatgaataaggaatctggg
cagtatcttgccggcagtgcaaagaaacaattgagctggcaggacacgcagagtttttgg
aaaacgtttagtgtcacctactga

DBGET integrated database retrieval system