KEGG   Fusarium graminearum: FGSG_11369Help
Entry
FGSG_11369        CDS       T01038                                 

Definition
(RefSeq) hypothetical protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
fgr  Fusarium graminearum
Pathway
fgr00010  Glycolysis / Gluconeogenesis
fgr00071  Fatty acid degradation
fgr00350  Tyrosine metabolism
fgr01100  Metabolic pathways
fgr01110  Biosynthesis of secondary metabolites
fgr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FGSG_11369
  09103 Lipid metabolism
   00071 Fatty acid degradation
    FGSG_11369
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    FGSG_11369
Enzymes [BR:fgr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     FGSG_11369
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2
Motif
Other DBs
NCBI-GeneID: 23558215
NCBI-ProteinID: XP_011325868
Position
3
AA seq 312 aa AA seqDB search
MTLAGGYLGPCRDILGHEGVGRVVQIGSGVDPSTIKVGDRIGIAWVRDACGQCSCCREPG
GEVRCLEQQNSGRKWDGTFADHCIVPSRYVLTLPDDPKLPDEIVAPILCGGVTAYKALKA
CEATPGDWVAIVGAGGGVGGLGIQYAKAMGYRVAAVDVGPAEDFCLKMGADAYFDGSSPD
TPAKLKKLTPNGAGAKTVIVTAGSGRAYQNALDLVAVFGTLVCVGIPPPDQAMNLHPLTL
IDRGIKLLGTLVGTRTETLEALEFVRRGVVEPIVQTVNFNEIEDLAARFLTALFLKKVHA
PIMPGILVRADP
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcgctggtggctatctaggcccttgtcgcgatatcctcggccacgaaggagta
ggccgtgtcgtgcaaattggttccggcgtagacccatccaccatcaaagtgggtgatcgt
atcggaattgcttgggtgcgagatgcttgtgggcaatgctcctgctgtcgtgaacccggc
ggtgaagtccggtgcttggagcagcaaaactcagggcggaagtgggacggcacatttgct
gatcactgtattgttcctagtcgatacgtcttgacacttccggatgatccgaagctacca
gatgagattgtggcgcctatactatgcggaggcgttactgcctacaaggctttgaaggct
tgcgaagctacaccaggagattgggtcgccatagtcggagcaggcggtggagtaggaggt
cttggaatacagtatgccaaggctatgggataccgagtggcagcagttgacgtcggcccc
gcagaggacttttgtctgaaaatgggtgccgatgcctactttgacggctcaagtcctgat
acaccagcaaagttgaagaagctaactccaaacggcgctggagcaaaaacagtcatagtc
acagcaggatcaggtagggcttatcagaatgcccttgatcttgttgctgtctttggtacg
cttgtttgtgtggggataccacctcctgatcaagcaatgaacctgcatcctctgactctc
atagatcgagggattaagcttctcggaacgttggtgggaacaaggaccgaaacacttgag
gctcttgagtttgtgcgaagaggtgtcgtcgagcctattgttcagacagtcaatttcaac
gaaatagaagatctagcggcgaggttcttaactgctttatttcttaagaaggtccatgca
cccatcatgcctggaatccttgtccgggcggatccatga

DBGET integrated database retrieval system