KEGG   Fusarium graminearum: FGSG_12495Help
Entry
FGSG_12495        CDS       T01038                                 

Definition
(RefSeq) trans-aconitate 2-methyltransferase
  KO
K00598  trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
fgr  Fusarium graminearum
Brite
KEGG Orthology (KO) [BR:fgr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FGSG_12495
Enzymes [BR:fgr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     FGSG_12495
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_31 Methyltransf_11 Methyltransf_12 Methyltransf_23 MTS Methyltransf_2 CheR TehB PCMT FtsJ Methyltransf_32 Methyltransf_4 Methyltransf_9 CMAS Ubie_methyltran Methyltransf_18 Methyltransf_5
Motif
Other DBs
NCBI-GeneID: 23559308
NCBI-ProteinID: XP_011322576
UniProt: I1S6M3
Position
2
AA seq 266 aa AA seqDB search
MAQANKDTWSADQYSKFLKDRTRPSIDLLAHVPNLSPKRVVDIGCGPGNSTAVLVDQYPN
AKISGFDTSPDMIRKAKETLPNVDFEVADLQSFKPDVPVDVLFSNAVFQWLPNGKRIEIV
TRLMDHLTPGGSLAFQIPYNLNEPSHASMREVADMPNKPWSETLKRANISRDQFPSPTEI
WDGLKPLCADLDIWQTTYMHVMENHEGIVEWVKGTGLRPYVDPLDENAKKEYIETYLGKL
KKAYKAQNDGKVLLPFPRLFVVATKA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggccaacaaggatacgtggtccgcagaccaatactccaagtttctcaaagat
cgcacaagaccttcgatagatctcttggcgcacgtgcccaacctctcgccaaagcgcgtc
gtggatatcggctgtggacccggtaactcaaccgccgtgttggtagatcaatatcccaat
gcaaagatctcgggctttgatacgtcccctgacatgatcaggaaggccaaggaaactttg
ccaaacgtggactttgaggttgccgacctccaatccttcaagcccgacgttcctgttgat
gtgctcttttccaatgccgtgtttcagtggctacccaatgggaagcgcatcgagattgtt
acacggcttatggatcatctcacgccaggcggaagtctcgcgttccagattccctacaac
cttaacgagcccagccacgcttcgatgcgcgaagtggctgacatgcccaacaaaccctgg
tccgagacgctcaagcgcgccaacatttcccgtgaccaattcccttcaccaaccgagatc
tgggatggcctcaagcctctctgcgcagatcttgacatctggcagacgacatacatgcac
gtgatggagaaccatgaaggtattgtcgaatgggtcaagggtacgggtcttcgtccttat
gtggacccgcttgacgagaacgcgaagaaagaatacattgagacatacctgggaaagctg
aagaaggcttacaaggcgcaaaatgatggaaaggtgcttttgccgttccctagattattt
gttgttgcgacaaaggcataa

DBGET integrated database retrieval system