KEGG   Allofrancisella guangzhouensis: SD28_03880Help
Entry
SD28_03880        CDS       T03527                                 

Definition
(GenBank) mannose-6-phosphate isomerase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
fgu  Allofrancisella guangzhouensis
Pathway
fgu00051  Fructose and mannose metabolism
fgu00520  Amino sugar and nucleotide sugar metabolism
fgu01100  Metabolic pathways
fgu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SD28_03880
   00520 Amino sugar and nucleotide sugar metabolism
    SD28_03880
Enzymes [BR:fgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     SD28_03880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase MannoseP_isomer Cupin_2 NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AJC48832
UniProt: A0A0A8E5F1
Position
827762..829132
Genome map
AA seq 456 aa AA seqDB search
MINIVLCGGSGTRLWPLSRTLFPKQFVRLFNGKSLFQETLLRNSATCEKTLIVSNVEQYF
LALDQIREINLEVYKYILEPIARNTAPAIALACLALNADDIVLITPSDHLIKNQNAYQKA
LLEAKELASQGNIVTFGIKPIKPETGYGYIHANGTDVLSFKEKPDFDTAKKYIEEKNYFW
NAGIFCCKAGVYLEELKKYAEEIYYKSEKAFNGSLGHEVRIDGKAMLDIPSDSIDYAVIE
NSSKVKMVQCENIDWSDLGSFDSLDEQIHKDVNGNSIVKADEVKEPVFLNSTNNLLVTES
RQVSMIDINNLLVIDTADALLIARKGSSQGVKKILEKVSTYNPELAEKHTLVFRPWGNYR
VLINSVSYKVKKIVLNPKSKLSLQKHQQRNEHWVVLSGIATVTLEDEIFKLRKNESTYIT
AGQKHRLENQQNVPLIIIEIQVGGYVSEDDIISFGI
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
gtgataaatatagtattgtgtggtggttctggtactagattatggcctttgagtaggaca
ttgtttcctaaacagttcgtgcgactttttaatggtaagtcattatttcaagaaacgtta
ttaagaaattcagctacctgtgaaaaaacattaatagtttcgaatgtggagcaatatttt
ctagctctagaccagataagagaaataaatttagaggtttataaatatatattagagcct
atagctagaaatacagcaccagctatagctcttgcatgtttagctttaaatgctgacgat
atagttttaataacgccatctgaccaccttataaaaaaccaaaatgcgtatcaaaaggct
ttattagaagcaaaagagttagcaagtcagggtaatatagtaacttttggcattaaacca
attaagccagaaacaggctatggttatattcatgctaatggtactgatgttttatccttt
aaagaaaaacctgactttgatacagcaaaaaaatatatagaagaaaaaaattacttttgg
aatgcaggtatattttgttgtaaagcaggtgtttatttagaagagcttaagaaatatgct
gaggaaatatattataaatcagaaaaagcttttaatggtagcttaggtcatgaggttagg
atagatggaaaagctatgttagatattccaagtgatagcattgactatgctgttattgag
aacagtagtaaagttaagatggtgcaatgtgaaaatattgattggtcagatctgggtagt
tttgattctttagatgaacagattcacaaggacgtaaatggtaattctattgttaaagcc
gatgaagtaaaggaacctgtttttttaaactccactaacaatttattagtcacagaatcc
cgccaagtttcaatgattgatattaataaccttttagtgattgacaccgctgatgccctt
ttaatagccagaaaagggtcttcacaaggtgtaaaaaaaatattagagaaggtaagtact
tataatccagagttagcagaaaaacatacccttgtttttagaccttggggaaattataga
gtactcattaactcagttagctataaagtaaaaaaaatagtacttaacccaaaatctaaa
ctatctctgcaaaaacatcaacaaagaaatgaacactgggttgttttatcaggtattgct
acagtcacattagaagatgaaatttttaagcttcgcaaaaacgagtcaacttatataact
gcaggtcaaaaacataggttagaaaatcagcaaaatgttcctctaattataatagaaata
caagttggaggatatgttagtgaagatgatataataagttttggcatttaa

DBGET integrated database retrieval system