KEGG   Allofrancisella guangzhouensis: SD28_06810Help
Entry
SD28_06810        CDS       T03527                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
fgu  Allofrancisella guangzhouensis
Pathway
fgu00020  Citrate cycle (TCA cycle)
fgu00480  Glutathione metabolism
fgu01100  Metabolic pathways
fgu01110  Biosynthesis of secondary metabolites
fgu01120  Microbial metabolism in diverse environments
fgu01130  Biosynthesis of antibiotics
fgu01200  Carbon metabolism
fgu01210  2-Oxocarboxylic acid metabolism
fgu01230  Biosynthesis of amino acids
Module
fgu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fgu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:fgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SD28_06810
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SD28_06810
Enzymes [BR:fgu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SD28_06810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH FliN_N
Motif
Other DBs
NCBI-ProteinID: AJC49349
UniProt: A0A0A8E5U6
Position
complement(1450520..1452736)
Genome map
AA seq 738 aa AA seqDB search
MHKIFYTMTDEAPALATGSFLPIAQSFTKLADIALETKDISLASRILANFNDYLTDQQKC
SDDLAILGELAKTPDANIIKLPNISASVPQLTAAIKELQTKGYDIPDYPFEPKDEKEQEI
KSRYSKVLGSAVNPVLREGNSDRRVAAAVKAYAQKHPHSMGEWTKDSKSHVASMSDNDFY
ANEKSYIVPKAMTVKIVHIDNKGKETVLKAGLKLEEKEIIDATKISAKALREFYKQEIQN
AKKEGTLLSLHLKATMMKVSDPILFGHAVEIFFEDVFKKYAKEFKELGVNPRNGWGDAVE
KIKQLPQELQDKINADIEKVFTKQPDIAMVNSDKGITNLNVPSDVIIDASMPAAIRSSGK
MWNKNGQLQDIKAMIPDRCYAGVYAATIGFCRENGAFDVATMGDVSNVGLMAKKAEEYGS
HDKTFEIQADGKVLVIDAEDNVIFEHGVEEGDIWRACQTKDIAVKDWVKLAVNRAKVTQN
PAIFWLDAKRAHDRNLIAKVHEYLTLHDTTGLNIEILSPVEATKYSLKRMKEGKDTISVT
GNVLRDYLTDLFPILELGTSAKMLSIVPLLAGGGLFETGAGGSAPKHVEQLINENHLRWD
SLGEFLALGASLEDLAIKTRDPKIKVLAEGLGQANKDFLDNDKSPRRKVGELDTRGSHFY
LAFYWAKALAEQNGEQELKAKFEPIYQELKANEEKIVRELASVQGKKVDIGGYYLPESSK
LGSVMRPSKTFNNILTKV
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgcataaaatattttatacaatgactgatgaggcgccagcattagcaactggctcattt
ttaccaatagctcaaagttttactaaactagcggatattgctttagagacaaaagacata
tcattggcatcacgtatattagctaattttaatgattatctgacagaccagcaaaaatgt
tctgatgatcttgctattttaggtgagctagcaaagacaccagatgctaatattattaaa
ttacctaatataagtgcctctgtaccgcagctaacagcagctataaaagagctgcaaaca
aaagggtatgatatccctgattatccgtttgagcctaaagatgaaaaagagcaagaaata
aaaagtcgctactcaaaagtgttaggaagtgctgtaaacccagttttaagagaaggtaat
tctgatcgtcgtgtagctgcagctgttaaagcttatgctcaaaagcatccacattctatg
ggtgagtggacaaaagattctaaatctcatgttgcaagtatgtctgataatgatttttac
gcaaatgaaaaatcttatatagtacctaaagcaatgactgtgaaaattgttcatattgat
aacaagggtaaagaaactgtgttaaaagcaggcttaaaattagaagaaaaagaaatcatt
gatgcaactaaaatttctgcaaaagctctaagagagttttataaacaagaaatacaaaac
gctaaaaaagagggcacattactttctttacatttaaaagcaaccatgatgaaagtttct
gacccaatcttgtttggccatgcagtagagattttctttgaagatgtgttcaaaaaatat
gcaaaagaatttaaagagttaggcgtaaatccacgtaatggctggggtgatgcagttgag
aaaataaaacaacttcctcaagaacttcaagataaaataaatgctgatatagaaaaagtt
tttactaagcaacctgatattgctatggttaattcagacaaaggtattacaaacttaaat
gttccaagtgatgtaattattgatgcatccatgccagcagctattcgttcatctggaaag
atgtggaataaaaatggccagcttcaagatataaaagctatgattcctgatagatgttat
gctggtgtgtatgctgcaactataggtttttgtagagagaatggagcttttgatgttgca
actatgggtgatgtttcaaacgttggtttgatggctaaaaaagcagaagagtatggttca
cacgataaaacatttgagatacaggctgatggtaaagtgttagttatagatgctgaagat
aatgttatatttgaacatggtgttgaagagggcgatatttggagagcttgccaaactaag
gatatagcggttaaagactgggttaaactagctgttaatagagctaaagttacacaaaat
ccagctattttctggttagatgctaagagggctcatgatagaaatctcattgctaaagta
catgagtatttaactttacatgatacaacaggtcttaatatcgaaatactttcaccagtt
gaagctacaaaatactctttaaagaggatgaaagagggtaaagatactatttctgtcaca
ggtaatgttttaagagattatctgacagatcttttccctattttagagcttggtacaagt
gctaagatgctttctattgtaccacttcttgctggtggtgggctatttgaaactggtgca
ggtggttcagctcctaaacatgttgagcagttaattaatgaaaatcatctaagatgggat
tctttaggggaatttttagcgttaggagcttctttagaagatttagcgatcaagactaga
gatcctaaaattaaagttcttgctgagggcttaggccaggcaaataaagactttttagat
aacgataaatcacctcgccgtaaggttggcgagcttgataccaggggtagtcatttttat
ttagccttttattgggcaaaagcattagctgagcaaaatggagaacaagagttaaaagct
aaatttgaaccaatttaccaagagctaaaagctaatgaagaaaaaattgttagagagtta
gctagtgttcaaggtaaaaaggttgatataggtgggtattatttaccagagtctagtaag
cttggtagtgtgatgaggccaagtaaaactttcaataatattttgactaaagtatag

DBGET integrated database retrieval system