KEGG   Francisella halioticida: CDV26_02965Help
Entry
CDV26_02965       CDS       T04972                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
fha  Francisella halioticida
Pathway
fha00010  Glycolysis / Gluconeogenesis
fha00020  Citrate cycle (TCA cycle)
fha00620  Pyruvate metabolism
fha01100  Metabolic pathways
fha01110  Biosynthesis of secondary metabolites
fha01120  Microbial metabolism in diverse environments
fha01130  Biosynthesis of antibiotics
fha01200  Carbon metabolism
Module
fha_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDV26_02965 (aceF)
   00020 Citrate cycle (TCA cycle)
    CDV26_02965 (aceF)
   00620 Pyruvate metabolism
    CDV26_02965 (aceF)
Enzymes [BR:fha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CDV26_02965 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_D23 DUF2118 HlyD_3
Motif
Other DBs
NCBI-ProteinID: ASG67492
UniProt: A0A2Z2L4K4
Position
539050..540918
Genome map
AA seq 622 aa AA seqDB search
MSIEIVKVPDIGNYDSVDVIELNVAEGDIVAEEDSLITLETDKASMEVPSPVAGKIVKLT
VKVGDKVSEGSVIMEVELEGSANTAAQEKPAQQVEAAQTPSSATEIVDVKVPDIGDYDAA
EIIEVSVNVGDEIAEEDSLITLETDKASMEVPSSASGKVVEIAVKVGEKVDEGDLILKVE
SGASQSAPVQQQTQQSVPAQISEEIVEVQVPDIGDYDSVDVIEVSVAVGDKVEEEDSLIT
LETDKASMDVPSPVVGEVTEIITKVGDKVSQGSLILKVKTQGSAPATASSQPAKQETPKQ
ASQAAPAQNSVNEYEVDNSNAHASPAVRKLARILNVDLSKVKATGRKGRVTKEDCYNYIK
HAVTQVQTGKVAASGSGLDLLDDPVIDFSKFGEIETQPLTRINKISAKNLHRNWVKIPHV
TFYDDADVSDLEEFRKSKKAVAEKIGVKITPLSFLVKAAAVALQEFPKMNSSLSNDGENL
ILKKYYNIGFAADTPAGLMVPVIKDADKKGIIEISKDIMALAGKARDGKLGSKDMSGATF
TISSIGVLGTTAFTPIINMPEVAIMGVSKTAVKPIWNGKEFEPRTMLPLSMSADHRVIDG
ALAAKFLTRYSQILSDLREIIM
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgtctatagagatagttaaggttcctgatattgggaactatgatagtgtagatgtaatt
gaattgaatgttgctgagggcgatattgttgctgaggaagattctttaattacactagaa
actgataaagccagtatggaggttccatctccagtagctggtaaaattgttaagctaact
gtaaaagttggtgataaagtttcagaaggttctgtaattatggaagttgaacttgaaggt
tcggctaatacagcagcacaagaaaagcctgcacaacaagtagaagctgcacaaactccg
tctagtgcaactgagattgttgatgtgaaggttccagatattggtgactacgatgcagct
gaaattattgaagtatctgtaaatgtaggtgatgaaatagctgaagaagattctttaatc
acgttagagactgataaagcgagtatggaagtcccatcatctgcaagtggtaaagttgtt
gagatagctgtgaaggttggtgaaaaggttgatgaaggtgacttgatacttaaggttgaa
agtggtgcaagccagtcagctccagtgcaacagcaaactcaacaatcagttccagcccaa
atttctgaagaaattgtagaggtgcaagttccagatattggtgattatgacagtgttgat
gttattgaagtctctgtggcagttggcgataaagttgaagaagaagattctttaataact
cttgagactgataaggctagtatggatgttccatccccagtagtaggtgaagttacagag
attattacaaaagttggagataaagtttcacaaggtagcttaatccttaaagttaaaact
caaggatctgctccagcaacagcgtctagtcagccagctaagcaagaaactcctaagcaa
gcttctcaagcagcaccagctcaaaacagcgttaatgaatatgaagtagataattcaaat
gcacatgcttctccagctgttagaaaattagctagaattttaaatgttgatctaagtaag
gtgaaagctacaggtcgtaaaggtcgcgtaacaaaagaagattgctataactacatcaag
catgctgtgacacaagttcagaccggtaaagttgccgcaagtggtagtggtttagatctt
ttagatgatcctgttattgatttctctaaatttggtgagattgaaactcaacctttaact
cgtattaataaaattagtgcgaaaaatctacatagaaactgggtgaaaattcctcatgta
actttctatgatgatgcagatgtttctgatcttgaagagtttagaaaatctaagaaagca
gttgctgagaaaataggtgtgaaaattacgccactttcattcttagtaaaagctgcggca
gtagctttacaagaatttccgaaaatgaatagttctctttcaaatgacggtgagaacttg
attcttaaaaagtattataatattggttttgctgcagatacccctgcaggattaatggtt
ccagttatcaaagatgctgataaaaagggtattattgaaatatcaaaagatattatggca
ttagctggcaaggctcgtgatggtaaattaggctctaaagatatgtccggagcaacattt
actatctcaagtatcggtgtgcttgggactacagcatttacgccgattattaatatgcca
gaagtagctatcatgggtgtatctaaaacagcagttaagccaatttggaatggtaaagag
tttgaacctagaactatgttgcctttatctatgtcagcagatcatagagttattgatggt
gcattagctgctaagttcttaacaagatatagtcagattctttctgatttacgtgaaatc
ataatgtaa

DBGET integrated database retrieval system