KEGG   Francisella halioticida: CDV26_06680Help
Entry
CDV26_06680       CDS       T04972                                 

Definition
(GenBank) succinate--CoA ligase subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
fha  Francisella halioticida
Pathway
fha00020  Citrate cycle (TCA cycle)
fha00640  Propanoate metabolism
fha00660  C5-Branched dibasic acid metabolism
fha01100  Metabolic pathways
fha01110  Biosynthesis of secondary metabolites
fha01120  Microbial metabolism in diverse environments
fha01130  Biosynthesis of antibiotics
fha01200  Carbon metabolism
Module
fha_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fha_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CDV26_06680
   00640 Propanoate metabolism
    CDV26_06680
   00660 C5-Branched dibasic acid metabolism
    CDV26_06680
Enzymes [BR:fha01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CDV26_06680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: ASG68114
UniProt: A0A2Z2L8K1
Position
1242490..1243362
Genome map
AA seq 290 aa AA seqDB search
MSVLIDKDTKVLVQGFTGKNGTFHSEQAIAYGTKIVGGVTPGKGGQTHLDRPVFNTMEEA
VKATGADASVIYVPAPFVKDSAIEAIDSGVKLIVIITEGVPTLDMLVVKEYLKGKDVQVV
GPNCPGVITPGECKIGIMPGHIHQPGRVGIISRSGTLTYEAVAQTTKLGFGQSTCIGIGG
DPIPGMNQIEALKLLENDPQTEAIILIGEIGGTAEEEAAEYIKDNVTKPVIGYIAGVTAP
PGKRMGHAGAIISGGKGTADEKFAAFEAAGIAYTRSPAELGSRLKEVTGW
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtattaattgataaagatacaaaagttttagtacaaggttttactggtaaaaat
ggtacttttcattcagagcaagctattgcttatggtacaaagatcgttggcggtgtaact
cctggtaaaggtggtcaaactcatttagacaggcctgtttttaacacaatggaagaagct
gtaaaagctactggtgcagatgcatctgtaatctatgtacctgctccatttgtaaaagat
tctgcaatcgaagctattgattctggtgttaaactaattgtgatcattactgaaggtgtt
cctactctagacatgttagtagttaaagaatacttaaaaggtaaggatgtacaagtagtt
ggccctaactgccctggtgttatcactccaggtgaatgtaaaattggcattatgcctggg
cacatccatcagcctggtagagttggtatcatctctcgttctggtactttgacttatgaa
gcagttgctcaaactactaaactaggttttggccaatcaacttgtataggtataggtggt
gatccaatccctggtatgaaccaaattgaggctctaaaacttctagagaatgatccacaa
acagaagctataatcttaattggtgagattggcggtacagctgaagaagaagctgctgaa
tatatcaaagataatgtaactaagccagttattggatacattgctggtgttacagcccct
ccaggaaaacgtatgggccatgctggtgctattatctctggaggtaagggtacagctgat
gagaaatttgctgcttttgaagctgctggtattgcttataccagatcacctgcagagcta
ggctctaggcttaaagaagttactggttggtaa

DBGET integrated database retrieval system