KEGG   Francisella halioticida: CDV26_09465Help
Entry
CDV26_09465       CDS       T04972                                 

Gene name
metG
Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
fha  Francisella halioticida
Pathway
fha00450  Selenocompound metabolism
fha00970  Aminoacyl-tRNA biosynthesis
fha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fha00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CDV26_09465 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CDV26_09465 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:fha01007]
    CDV26_09465 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:fha03016]
    CDV26_09465 (metG)
Enzymes [BR:fha01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CDV26_09465 (metG)
Amino acid related enzymes [BR:fha01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CDV26_09465 (metG)
Transfer RNA biogenesis [BR:fha03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CDV26_09465 (metG)
 Prokaryotic type
   Other AARSs
    CDV26_09465 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ASG68589
UniProt: A0A2Z2L2E1
Position
1783207..1785231
Genome map
AA seq 674 aa AA seqDB search
MRKILVTNALPYANGDLHLGHMLGYIQSDIWVRFQKLQGNKCIFVCGSDTHGTPIMLKAK
NLGISPDELVEKYSNNHQKDFADFEITFDNYYSTHNSLNKEIVEDIYNKLNEQKLISKKE
IAQAYDLEAKMFLPDRFVKGICPKCKAEDQYGDSCEVCGATYDPTELINPKSVISGKAPI
QKNSEHFFFDLPALTNDIENWIKSNKNLQPEVANKLSEWFKQGLQSWDISRDAPYFGFAI
PGTNEQKFFYVWLDAPMGYIASFKDFCNKNNVNFDQYWGDSSNESELYHFIGKDIIYFHA
LFWPAILASTGYKTPTSVFANGFLTVNGKKMSKSRGTFIQARTYLDSLEPSYLRYYFASR
LTSRIDDIDLNLEKFVTKSNSDIVGKVVNIASRCAGFVYKKFDATLADEIFDKGLEKEFA
ENHSTITQAFEKREFASAVRLIMSLADKANQFIDYHKPWQLAKEEGQEQKVHQVCSQGIN
MFKVLASYLKPIIPNIATKAELFLNIEISNWDDSPVFLRNHKINKFKPLAIRIEKEKVDK
IIEDTKKMLEKEQSQPPKKEESKLDIADECTFDDFMKIDLRVAKIIEASYVEGADKLLKL
ILDLAGVKKQVFAGIKSSYNPEELVGKHTVMVANLAPRKMKFGISEGMILAAGDNKGIYI
LEPHDGAQPGMRVK
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaattctagttactaacgcccttccttatgcaaatggagaccttcatttaggt
catatgcttggctatatacagtcagatatctgggttagattccaaaaattacaaggaaat
aaatgcatatttgtctgtgggagcgatactcatggcacaccaattatgctaaaagcaaag
aatctaggtatatccccagatgaattagtagaaaaatattcaaataatcaccaaaaagat
tttgctgattttgaaattacttttgataactactactcgacacacaactctctaaacaaa
gaaattgtcgaagatatttacaataagctaaatgaacaaaaacttatatcaaagaaagaa
atagctcaagcatatgatcttgaagctaaaatgtttttacctgataggttcgtaaaaggt
atatgtccaaaatgtaaagctgaagatcaatatggtgatagctgtgaagtttgtggtgcc
acttacgatcctaccgaattaataaatccaaaatcagttatttctggtaaagctcctata
caaaaaaattcagagcactttttctttgacctaccagcattaacaaatgacatagaaaac
tggattaaatctaataaaaacctacaacctgaggttgcaaacaagttatctgaatggttt
aaacaaggcttacaaagctgggatatctcgcgtgatgcgccatattttggttttgcaata
cctggaacaaatgaacaaaaattcttctatgtctggctagatgcccctatgggttatatt
gcaagtttcaaagatttttgtaataaaaataatgttaattttgatcaatattggggcgat
agctccaatgaaagtgaactttaccacttcattggaaaagatattatttatttccacgca
ctattctggccagcaattctagcttctacaggttataaaactcctacaagtgtatttgct
aatggttttttaactgtaaacggtaaaaaaatgtctaaatctcgcggaacttttattcaa
gctagaacatatttagatagcctagaacctagttatttaaggtattattttgcatcaaga
ctaacatcacgcattgatgacatagatttaaacctagaaaagtttgttacaaaatcaaac
tctgatattgttggaaaagtagtaaatattgctagtcgttgtgccggctttgtttataaa
aaatttgatgccactttagctgatgaaatttttgataaaggattagaaaaagaatttgct
gagaaccatagcacaataactcaagcttttgaaaaaagagaatttgcgagcgccgttaga
cttataatgtcactagcagataaggcaaaccaatttattgactatcataagccttggcaa
ctagctaaagaggaaggacaagaacaaaaagttcatcaagtatgctcgcaaggtataaac
atgtttaaggttttggcttcatatcttaagccaattatcccaaacattgctacaaaagca
gaacttttcttgaatatagaaatttctaactgggatgactctccagtatttttgagaaac
cacaagataaataaattcaaacctcttgctattcgtatagaaaaagagaaagttgacaag
attatagaggacacaaaaaaaatgttagaaaaagagcaatctcaaccgcctaaaaaagaa
gagtctaaacttgatatagctgatgaatgcacttttgatgactttatgaaaatagatctt
cgtgtagctaaaatcatagaagcctcatatgttgaaggggcagataagttacttaaacta
atactagatttagccggggttaaaaaacaggtttttgctggtataaaatcatcttacaat
cctgaagaacttgttgggaaacataccgtaatggttgcaaatttagcccctagaaaaatg
aagtttggtatttctgaaggcatgatacttgctgcaggagataataaaggaatatatata
ttagagccacacgatggtgctcaacctggcatgcgtgtcaaataa

DBGET integrated database retrieval system