KEGG   Francisella hispaniensis FSC454: FSC454_01145Help
Entry
FSC454_01145      CDS       T04700                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
fhi  Francisella hispaniensis FSC454
Pathway
fhi03010  Ribosome
Brite
KEGG Orthology (KO) [BR:fhi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    FSC454_01145
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:fhi03011]
    FSC454_01145
Ribosome [BR:fhi03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    FSC454_01145
  Bacteria
    FSC454_01145
  Archaea
    FSC454_01145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: APD49846
UniProt: A0A153JLI9
Position
234131..234466
Genome map
AA seq 111 aa AA seqDB search
MEVQAKLKFARISAQKCRLVADQIRGLPVEQAINLLTFSNKKAAVLIKGVLSSAVANAEH
NDGMDVDSLVVSTIFVDEGPTMKRFEARAKGRGNRILKRTSHITVKVAEKK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggaagtacaagctaaattaaaatttgcaagaatctcagctcagaaatgtagattggtt
gctgatcagatcagaggtctgcctgttgagcaagctattaatcttttgacttttagcaat
aagaaagctgcagtattgatcaagggtgttttgagctctgcagttgctaacgctgagcat
aatgatggtatggatgttgactctctagttgtgtcaactatcttcgttgatgaaggtcct
acaatgaagcgctttgaagctagagcaaaaggtcgtggtaatcgtattctaaaaagaact
tcacatataactgtgaaagttgctgagaaaaaataa

DBGET integrated database retrieval system