KEGG   Fusobacterium hwasookii: RN87_08665
Entry
RN87_08665        CDS       T04183                                 

Definition
(GenBank) ornithine aminomutase
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
fhw  Fusobacterium hwasookii
Pathway
fhw00472  D-Arginine and D-ornithine metabolism
fhw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fhw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    RN87_08665
Enzymes [BR:fhw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     RN87_08665
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A
Other DBs
NCBI-ProteinID: ALQ40597
UniProt: A0A0S2ZNR4
Position
complement(1876112..1876486)
AA seq 124 aa
MKGYLKRDDDFEERRKKLANLSDEELKNRFWQLAEQVVEPLLKMAKENTTPSIERSVLLR
MGFSTLEVRPLVDGAIERNLIGKGVGHIVYRVAKEKGISIREAGEKLIAGDYWDLALEIF
KGGR
NT seq 375 nt   +upstreamnt  +downstreamnt
atgaaaggatatctaaaaagagatgatgattttgaagaaagaagaaaaaaactagcaaat
ctttcagatgaagagttaaaaaatagattttggcaattagctgaacaagttgtagaaccc
ctattaaaaatggctaaagaaaatactactccttcaatagaaagatctgtattacttcgt
atgggcttctcaactcttgaagtaagaccccttgtagatggagctattgaaagaaatctt
ataggaaaaggtgtgggacatatagtatatagagttgctaaagaaaaaggtatttctata
agagaagctggagaaaaattaattgctggagactattgggatttagcattggaaatcttt
aaagggggtagataa

DBGET integrated database retrieval system