KEGG   Fervidobacterium islandicum: NA23_02550Help
Entry
NA23_02550        CDS       T04215                                 

Definition
(GenBank) glycosyl hydrolase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
fia  Fervidobacterium islandicum
Pathway
fia00511  Other glycan degradation
fia00600  Sphingolipid metabolism
fia01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fia00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    NA23_02550
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    NA23_02550
Enzymes [BR:fia01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     NA23_02550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_59 Glyco_hydro_30C Glyco_hydr_30_2
Motif
Other DBs
NCBI-ProteinID: AMW33672
UniProt: A0A1B0VNN7
Position
complement(549983..551416)
Genome map
AA seq 477 aa AA seqDB search
MGVLMIVLFISSSSTPVLYSERKEGEIKVSELKVWLTTSDQKHLLKEVDPSISLASSYQE
QFKIVVDERKKYQQMDGFGASFTDASAYLVYNKLTPEKRREVMEKLFDREKGIGISFLRQ
PMGATDYTTKIYSYDDLPAGVTEDTELKYFSIEHDKQYIIPLLKEAIQINPEIKIMASPW
SAPGWMKTTGSMIGGSLRRSYYGVYAQYFVKFIKAYEAEGIPIYAITVQNEPLYVPKEYP
GMKMDWVEQADFIGEYLGPAFESAGIRTKILCYDHNWDNTTYAAYVLSNEKASKYVAGSA
WHFYGGKHEAMSKIKEMFQDKEIWFTEGSGGDWVPAFFNAYMDQMMHVIRIPRNWAKTVV
WWNIALDEKRGPTILSNSTCRGLIEINQQTGEVKYNVDYYTLGHISKFVRPGAYRIDSYT
YMDKLESVAFLNPDGSKVLIISNRTNTAKKIQVIKDDTELFSYVLPGYASATFVWKE
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgggcgttttgatgatagttctttttatttcctctagctccacaccagttttatactct
gaaaggaaggaaggtgagataaaagtgagtgagttgaaagtatggcttacaacgtctgac
cagaagcatcttttgaaagaagtcgatccttcaattagtttagcttcaagttaccaagag
cagtttaagatcgttgtcgacgaaaggaaaaaatatcagcagatggatggttttggtgct
tctttcactgatgcttctgcttatcttgtgtacaacaaacttaccccagagaagcgaagg
gaggttatggaaaagctttttgatagggagaaaggtataggtatttcgtttttgcgacag
ccgatgggcgcaacggactacacaacaaagatttacagttacgacgatcttcctgcggga
gttactgaagataccgaattgaagtatttctcgattgagcacgacaaacaatacattatc
ccactattaaaagaagccatccaaataaatcctgaaataaagattatggcttccccgtgg
agtgctccggggtggatgaagaccacgggcagtatgataggcggctctctcaggaggtct
tattacggagtttacgctcagtattttgtgaaatttataaaagcttacgaagctgaaggt
ataccgatttatgctattacagttcaaaatgaaccactgtatgttccaaaagaataccca
ggaatgaaaatggattgggttgagcaagcagatttcattggtgaatacttaggtcctgct
ttcgaaagtgcggggattaggacaaagattctttgctatgaccataactgggataacaca
acgtacgctgcgtacgtactttccaacgagaaagcttcaaaatacgtcgcaggttctgct
tggcatttctacggtggaaagcatgaggcaatgagtaagataaaggaaatgttccaggac
aaagagatctggttcacagaaggttctggaggagactgggttcctgcgtttttcaacgcg
tatatggaccaaatgatgcacgtgataagaattccaagaaattgggcaaagaccgtcgta
tggtggaacattgcgctggatgagaaaagaggtccaacaatattatcgaacagcacgtgc
agaggcctaatcgaaatcaatcaacaaacgggagaagttaagtacaacgtagattactac
acgcttggacacatcagtaagtttgttcgacccggagcatacagaatagattcttacacg
tacatggacaaactggaatccgtcgcgttcttgaacccagatggttcaaaggttctcatc
atttcgaatagaacgaatactgctaaaaagattcaggttatcaaagacgatacagaactc
ttttcgtatgttcttccaggctacgcatcagccacttttgtttggaaggaataa

DBGET integrated database retrieval system