KEGG   Fervidobacterium islandicum: NA23_04985Help
Entry
NA23_04985        CDS       T04215                                 

Definition
(GenBank) phosphotransferase
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
fia  Fervidobacterium islandicum
Brite
KEGG Orthology (KO) [BR:fia00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NA23_04985
Enzymes [BR:fia01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     NA23_04985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP_C PHP
Motif
Other DBs
NCBI-ProteinID: AMW32697
UniProt: A0A1B0VIX9
Position
1070388..1071080
Genome map
AA seq 230 aa AA seqDB search
MYRADLHVHSCLSPCAELTMVPSVVCNSELEVFSITDHNSARNVAVFTFLCKDKIIVPGI
EIHTLEDVHLLGYFPSIEDALAVSEFVEDMLPKFEYDPEKYGYEIVLDKNETFVGALDYY
LGFPTNLTIDDALELIKQHNGLAVLAHVDRKFGAIQQLGMVPPNVKYVEVRKREVALELR
AQGFVVLTSSDAHTPDEVGSRKVYFDEKPKSAEDVLQLIRERRFKTIWDL
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtatagagccgatctgcatgttcattcttgcttatctccctgtgcggaacttacaatg
gtcccttcggtagtgtgcaactctgaattggaggtattttctattaccgatcataactcc
gcacgaaatgttgcggtttttacttttttatgcaaagacaaaattattgttcctggtatt
gaaattcacacattggaagacgttcacttattgggttatttcccaagcatcgaggatgca
ttagctgtttcagaatttgtggaagatatgcttccaaaattcgaatacgacccagaaaaa
tatggttacgaaatagttttagataagaacgaaacgttcgttggagctctggattattac
cttggttttcctacgaatctaacaattgatgatgccttggaactgattaagcaacacaac
gggcttgcagtactcgcacacgttgacaggaagttcggtgcaattcagcaacttggaatg
gttccgcctaacgttaagtatgtggaggtacgaaaaagagaagtagccttagaattgaga
gctcagggattcgttgtgttaacttcttctgatgctcacacaccagatgaagtgggttcg
aggaaagtgtactttgatgaaaaaccaaagagtgcagaagacgtgttacagttaatccgg
gaaaggaggttcaaaacaatttgggacttataa

DBGET integrated database retrieval system