KEGG   Fervidobacterium islandicum: NA23_09990
Entry
NA23_09990        CDS       T04215                                 

Definition
(GenBank) ornithine aminomutase
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
fia  Fervidobacterium islandicum
Pathway
fia00472  D-Arginine and D-ornithine metabolism
fia01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fia00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    NA23_09990
Enzymes [BR:fia01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     NA23_09990
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A DUF2067
Other DBs
NCBI-ProteinID: AMW33522
UniProt: A0A1B0VNA0
Position
2136238..2136609
AA seq 123 aa
MKPRPDDFAERSKHLQNMTDEELNAYFWQLVEKVVDPLVELAKTHTSPSIERSVLLRMGF
NSLEAKKLVDMIFERGLLGKGAGHIVLRIAKEHNIDYIEAGRRMINGEYWDDVDRIFKGV
NHP
NT seq 372 nt   +upstreamnt  +downstreamnt
atgaagccaagaccagatgattttgcagaaaggtcgaaacaccttcagaacatgaccgat
gaagaactcaacgcctatttttggcaacttgttgaaaaagttgtcgatcctcttgttgaa
cttgcaaagacgcacacaagcccatctatcgaaaggtccgttctactgaggatggggttc
aacagtctggaagcgaagaaacttgtagacatgatctttgaacgaggccttcttgggaaa
ggtgctggtcacatcgtcttgaggattgccaaggaacacaacatagattacatagaggca
ggtagaaggatgataaacggcgaatattgggatgatgtggacaggattttcaaaggggtc
aaccacccctga

DBGET integrated database retrieval system