KEGG   Fervidobacterium islandicum: NA23_09995
Entry
NA23_09995        CDS       T04215                                 

Definition
(GenBank) LuxR family transcriptional regulator
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
fia  Fervidobacterium islandicum
Pathway
fia00472  D-Arginine and D-ornithine metabolism
fia01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fia00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    NA23_09995
Enzymes [BR:fia01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     NA23_09995
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: AMW33523
UniProt: A0A1B0VLP1
Position
2136935..2139133
AA seq 732 aa
MDKLDPKVPIDVEEILKDLDKYRPRRRGWTWRKKLPEGTKVDRYEYYQISEPLKNSIPLP
AAHYFNNIDPQPDVVITSEIASGRFEDDIRRMRMAAWHGADHIMVIRTLGQSHFDGLIEG
TPEGVGGIPITRKQVRATRKALDLIEDEVGRPINFHSYVSGVAGPEIAVLFAEEGVNGAH
QDPQYNILYRGVNPVRSFVDAAVAKKIMAWANMLQIDGAHNANASAKLAWTVMPELLVQH
GINCMFSVKVGMPKENIALSTVPPVIAPLPEMRIDLPYAVALRELFKGFKFRAQMNTRYI
ESDLFDATRVHVLNAVLSRLTSADLQSTITPDEGRNVPWHINSIRGVETAKHTLLAMDGI
KKYVKIDQEAIREKVRELKMRAILMLEEILEMGGYFEALEAGMFVDNGYYPERLGDGIAR
KKDGEIAAGTVVPREPDYMAPVCEHFGYNNLPDGLEKPCDLIGGCTFHKPEKIQFIDELD
ETDNVNLRLQRIKDMKARNVIKPEVEWYSDGWIQIDMTFALPEEYAEAAALAVCEKLGLE
DPTVIAKTVLHPAEGTYVEVKAKVPFEIKIDELKLPKKPETLPEEEIFEYVAKRPIKVVA
ATVGEDEHSVGLREILDIKHGGIEKYGIKYVYLGTSVPPEKLIDAAIETGADAILASMII
THNDVHIKNMRRLNELAIEKGIRDKVLIIVGGTQINNDMAVENGVDAGFGRGTKGIHVAS
FIVKKLKEKEGN
NT seq 2199 nt   +upstreamnt  +downstreamnt
atggataaactcgacccaaaagttccaatcgatgttgaagagatactgaaagacttagat
aaataccgtccaagaagaaggggctggacttggcgaaagaaacttccagaaggcacaaaa
gttgataggtacgaatactaccaaatcagcgagccattgaaaaacagcatcccactacca
gctgcgcattatttcaacaacatcgacccgcagccagatgtcgtaatcacaagtgaaatc
gcttccggaaggttcgaagatgacatcaggagaatgcgcatggcagcatggcacggtgcg
gatcatataatggtcatacggacacttgggcaatcgcacttcgacgggctcatcgaagga
accccagaaggcgtcggagggataccaatcacgagaaagcaagttagggcaaccagaaaa
gcgcttgatttgatagaagacgaagttggaagacctataaacttccacagctacgtttct
ggtgttgcaggtcctgagatagctgttctctttgcagaagaaggcgtcaacggtgctcac
caagacccgcagtacaacattctttacagaggtgtcaatcctgttagatcgtttgtcgac
gcagccgttgcaaaaaagataatggcatgggcgaacatgctccaaatagatggtgcacac
aacgcaaacgcatccgcaaaactggcgtggaccgtaatgccagaactactcgtccagcac
ggtatcaactgtatgttctccgtcaaagtcggaatgccgaaggaaaacatcgcactatca
acagttcctccggtgattgcaccgctaccagagatgagaatagacttaccatatgccgtc
gcacttagagaactattcaaaggattcaaattcagagcgcagatgaacacaaggtacatc
gaatcagaccttttcgatgcaacaagggtgcacgttttgaatgccgtactctcaagatta
acaagcgcggatttacaatcaacgataactcccgatgagggaagaaacgtgccatggcac
atcaactcgataaggggagtagaaacggcaaaacacacacttcttgcgatggacggaatc
aaaaagtacgtcaaaatcgaccaagaagcgattcgagaaaaagtcagagaactgaagatg
agggccattttgatgctcgaagagatcctcgaaatgggaggctacttcgaggcactcgaa
gcaggtatgtttgttgacaatgggtattatcctgaacgacttggcgatggtatcgcaagg
aagaaagacggagaaatcgctgcaggaacggttgttccaagggaaccagactacatggca
ccagtttgcgaacactttggatacaacaacttgccggatgggctcgaaaaaccgtgtgat
ctcatcggtggttgtacgttccacaaacctgaaaagatacagttcatagacgagcttgac
gaaacggataatgtcaatcttagactgcaacgcattaaagacatgaaagcaagaaacgtc
atcaaaccggaagttgaatggtattctgatggctggatccagattgatatgacgttcgca
cttccagaagagtacgcagaagcagcggctcttgcagtatgtgaaaagcttgggcttgag
gatcctacggtaattgcaaaaaccgtgctacatccagctgagggaacgtacgttgaagta
aaagcaaaagttccattcgaaattaagatagatgaattgaaacttcccaaaaaaccagaa
acacttccggaagaagaaatattcgagtatgtagccaaacgtccaataaaagtggtggca
gcaaccgtaggagaagacgaacattcggtcggcctgcgtgaaattcttgacatcaaacac
ggtggtatcgaaaaatacggaatcaaatacgtctaccttggtacaagcgttccaccagaa
aaactcatcgacgcagcaatcgaaacgggtgcggatgcgatacttgcttccatgatcatc
acacataacgatgtgcacattaagaacatgagaagactcaacgaacttgcaattgaaaaa
ggtataagggacaaggtattgataatcgttggtggaacacagataaacaacgacatggcc
gtagaaaacggtgtcgatgcaggattcggtagaggaacaaagggtatacacgttgcctca
ttcattgtaaaaaagctcaaagaaaaggaaggaaattaa

DBGET integrated database retrieval system