KEGG   Candidatus Filomicrobium marinum W: BN1229_v1_1328Help
Entry
BN1229_v1_1328    CDS       T03856                                 

Gene name
apaG
Definition
(GenBank) Protein ApaG
  KO
K06195  ApaG protein
Organism
fil  Candidatus Filomicrobium marinum W
Brite
KEGG Orthology (KO) [BR:fil00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BN1229_v1_1328 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 LTD
Motif
Other DBs
NCBI-ProteinID: CFX13317
UniProt: A0A0D6JD42
Position
1:complement(1255177..1255569)
Genome map
AA seq 130 aa AA seqDB search
MYEKVTRGIRIRVEPAFVQDQSSPDEGYFFWAYTVEITNESEHRVQLRSRFWQITDARGV
TEEVRGPGVVGQTPVIGPGETFTYTSGCPLGTPSGIMVGSYQMADQDGILFDVAIPAFSL
DCPYETHSVN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtatgagaaagtcactcgcggcattcggattcgcgtcgagccagcgttcgtccaagac
cagtcttcgcctgatgagggttatttcttctgggcctataccgttgaaataaccaacgag
agtgaacaccgcgtgcagcttcgttcgcggttctggcaaattacggacgcgcgcggcgtc
accgaagaggtgcgcgggccgggcgttgtcggccaaacgcccgttatcgggcccggcgaa
accttcacctacacatctggatgtccgctcggaacgccttcgggcatcatggtgggcagc
tatcaaatggccgatcaggatggcatcttgttcgacgttgctatcccagccttttcgctc
gactgcccctacgagactcactcggtgaactga

DBGET integrated database retrieval system