KEGG   Candidatus Filomicrobium marinum W: BN1229_v1_1635Help
Entry
BN1229_v1_1635    CDS       T03856                                 

Gene name
inhA
Definition
(GenBank) Isonitrile hydratase
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
fil  Candidatus Filomicrobium marinum W
Pathway
fil00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:fil00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    BN1229_v1_1635 (inhA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fil01002]
    BN1229_v1_1635 (inhA)
Enzymes [BR:fil01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     BN1229_v1_1635 (inhA)
Peptidases [BR:fil01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   BN1229_v1_1635 (inhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: CFX17697
UniProt: A0A0D6JEY8
Position
1:complement(1557580..1558314)
Genome map
AA seq 244 aa AA seqDB search
MDDTKHQIGLILFPQLTQLDLTGPFEVLARLPDAQVHLIWKDLDPVLSDVGLRILPTTTF
TDCPDLDVICIPGGPGMNDLLNDEEVLAFVRRQGANARFVTSVCTGALVLGAAGLLQGYK
AATHWASMHFLESFGATPVNTRVCIDRNRITGGGVTAGIDFGLLLAEALSDRMTAEKIQL
YMEYNPEPPFTAGSPDTAPPAVVSEFRSYAEGMLKRRGEAVAQAAQRLKETTSEQASFKQ
PLPR
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggatgacaccaagcaccagattggcctcattctctttccgcaactgacgcaactcgac
ctaacgggtcccttcgaagtgctggcgcggcttcccgacgcccaggtgcatctcatctgg
aaggacctagatccggtcctgagcgatgtcggcctgcggatcttaccgaccacgacattc
acggactgtccggatctcgatgtgatctgcattcctggcggtccaggaatgaatgacctg
cttaatgatgaggaagtacttgcgttcgtgcgccgtcaaggagccaatgcgcgctttgtc
acctcagtatgcaccggtgcgttagtactgggagccgctggtcttcttcagggctacaag
gcagcgacgcactgggcatccatgcattttcttgagtcgttcggtgccacgccagtcaac
acgcgcgtctgcatcgatcgcaaccgcataacgggcggtggagttaccgcaggcattgat
tttggattgctcctggcggaagcgctttccgaccgcatgaccgccgaaaagattcaactc
tatatggagtacaacccggagccgcccttcactgcaggctccccagacacagccccgcct
gccgtcgttagtgagttccgtagctacgccgagggcatgctgaagcgaaggggcgaggcg
gtcgcgcaggccgcgcaacgccttaaggagactacatcggagcaggcttcgttcaagcaa
cctctaccgaggtag

DBGET integrated database retrieval system