KEGG   Candidatus Filomicrobium marinum W: BN1229_v1_1757Help
Entry
BN1229_v1_1757    CDS       T03856                                 

Gene name
pckA
Definition
(GenBank) Phosphoenolpyruvate carboxykinase [ATP]
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
fil  Candidatus Filomicrobium marinum W
Pathway
fil00010  Glycolysis / Gluconeogenesis
fil00020  Citrate cycle (TCA cycle)
fil00620  Pyruvate metabolism
fil01100  Metabolic pathways
fil01110  Biosynthesis of secondary metabolites
fil01120  Microbial metabolism in diverse environments
fil01130  Biosynthesis of antibiotics
fil01200  Carbon metabolism
Module
fil_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fil00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN1229_v1_1757 (pckA)
   00020 Citrate cycle (TCA cycle)
    BN1229_v1_1757 (pckA)
   00620 Pyruvate metabolism
    BN1229_v1_1757 (pckA)
Enzymes [BR:fil01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     BN1229_v1_1757 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP
Motif
Other DBs
NCBI-ProteinID: CFX19710
UniProt: A0A0D6JF19
Position
1:1692497..1694086
Genome map
AA seq 529 aa AA seqDB search
MKTLKFALSSEGKGRTNNSAAELVEHAVRRNEGALAATGAFAVQTGQHTGRSANDKYIVS
DDETQSQIWWENSKAITPEQFDRLLADFQAYASGKELFVQDLFAGADPTYQLPTRIVTEL
AWHALFIRHLLRRPLKAQLEGFDPQFTVVNFPGFRADPQIHGTRSETVIACDFTRRMVLV
GGTGYAGETKKSVFSFLNYLLPSKGVMPMHCSANVGNDGGSAVFFGLSGTGKTTLSADPS
RTLLGDDEHAWSPDGIFNFEGGCYAKTLHLSAEAEPEIFAASNRFATVLENVVLDEDRMP
DFEDGSLTQNARSAYPLEAISNASETGRAGHPKSVVMLTADAFGVMPPIAKLNPAQAMYH
FLSGYTAKVAGTERGMGSEPQATFSTCFGAPFMPRHPSVYGNLLRKLIAEHGVACWLVNT
GWTGGKFGDGKRMPIKATRTLLNAALSGALANSPMRADPVFGFMVPTELEGVDPSILNPR
QTWSDPSLYDATAAQLVEMFNKNFAAFTDYVDQDVLAAGPVLSAVRAAE
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttgaagttcgccctgagttcagaaggtaagggacgcaccaacaattcggcg
gcagagcttgtcgaacacgctgtgcgccggaacgagggcgcgcttgcggccacgggcgcc
tttgcggtccagacagggcagcacacaggccgatcggccaatgacaagtacatcgtttct
gatgacgaaacccaatctcagatctggtgggagaattccaaagcgattacgcctgagcaa
ttcgatcgtcttctggcggacttccaagcttacgccagcgggaaagagctgttcgttcag
gaccttttcgctggggctgatccaacctatcaattgccaacccgcatcgttacggaattg
gcctggcacgcactctttatccgacaccttttgcgccgccctctgaaggcgcagctggaa
ggatttgatccgcagttcaccgttgttaatttcccgggcttccgtgctgatccgcaaatc
cacggcacgcggtcggagacggtgattgcgtgcgatttcacccgtcgaatggttctcgtg
ggcggtacggggtatgcaggtgaaaccaagaagagcgtattctccttcctgaactatctg
ctgccgtccaaaggcgttatgccgatgcactgctcggcgaacgtcggaaacgacggcggt
tctgccgtgttctttgggctatctggaaccgggaagacgacgctatcggcagatcccagc
cggacgctgttgggcgatgacgagcatgcctggtctccggacggcatcttcaactttgag
ggcggctgctacgctaagacgttgcatctttcggccgaagcagaaccggaaatcttcgcg
gcgtccaaccgctttgcgacggttctcgagaacgttgttctcgacgaagatcggatgccg
gacttcgaggacggcagccttacccagaacgcgcgctctgcttatccgctggaagccatt
tccaacgcgagcgagactggccgcgccggccatcctaagtccgtcgttatgctgacggcc
gatgcatttggcgttatgccgccaatcgccaagctaaatcccgcccaggcgatgtaccat
ttcttatctggttacaccgcgaaggttgccgggacggagcgtggcatgggcagcgaaccc
caagcaacgttctcgacgtgctttggtgcgccctttatgccccgtcacccctcggtctac
ggcaacttgctgcgcaagcttattgctgagcacggtgtcgcgtgttggctcgttaacacc
ggttggaccggtggcaagttcggtgatggcaagcgtatgccgattaaagcaacgcgcacg
ctgctgaatgccgcgttgtcaggtgcgttggcgaatagtccgatgcgggcagatcccgta
tttggctttatggttccgaccgaattggagggcgtggatccgagtattctcaacccacgc
cagacttggtcagatccgtcgctttacgatgctacggctgcgcagcttgttgagatgttc
aacaagaactttgcggccttcactgactacgtcgaccaagatgtcttggctgccgggcct
gtgctgtccgccgtccgggccgcggaatga

DBGET integrated database retrieval system