KEGG   Candidatus Filomicrobium marinum W: BN1229_v1_2883Help
Entry
BN1229_v1_2883    CDS       T03856                                 

Gene name
fadI
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
fil  Candidatus Filomicrobium marinum W
Pathway
fil00071  Fatty acid degradation
fil00072  Synthesis and degradation of ketone bodies
fil00280  Valine, leucine and isoleucine degradation
fil00310  Lysine degradation
fil00362  Benzoate degradation
fil00380  Tryptophan metabolism
fil00620  Pyruvate metabolism
fil00630  Glyoxylate and dicarboxylate metabolism
fil00640  Propanoate metabolism
fil00650  Butanoate metabolism
fil00900  Terpenoid backbone biosynthesis
fil01100  Metabolic pathways
fil01110  Biosynthesis of secondary metabolites
fil01120  Microbial metabolism in diverse environments
fil01130  Biosynthesis of antibiotics
fil01200  Carbon metabolism
fil01212  Fatty acid metabolism
fil02020  Two-component system
Brite
KEGG Orthology (KO) [BR:fil00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN1229_v1_2883 (fadI)
   00630 Glyoxylate and dicarboxylate metabolism
    BN1229_v1_2883 (fadI)
   00640 Propanoate metabolism
    BN1229_v1_2883 (fadI)
   00650 Butanoate metabolism
    BN1229_v1_2883 (fadI)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BN1229_v1_2883 (fadI)
   00072 Synthesis and degradation of ketone bodies
    BN1229_v1_2883 (fadI)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN1229_v1_2883 (fadI)
   00310 Lysine degradation
    BN1229_v1_2883 (fadI)
   00380 Tryptophan metabolism
    BN1229_v1_2883 (fadI)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN1229_v1_2883 (fadI)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN1229_v1_2883 (fadI)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN1229_v1_2883 (fadI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fil04147]
    BN1229_v1_2883 (fadI)
Enzymes [BR:fil01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN1229_v1_2883 (fadI)
Exosome [BR:fil04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN1229_v1_2883 (fadI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CFX39492
UniProt: A0A0D6JIX3
Position
1:complement(2805157..2806461)
Genome map
AA seq 434 aa AA seqDB search
MSKTLRRVAIIGGVRIPFCRSGTLYADLSNLDMMTAALSGLVDRFNLKGAHVDEVVGGAV
VTHAKDWNLAREAVLSTTLAPSTPGITMMQACGTSLQAAMGIAAKIAAGQIESGIAVGSD
TTSDPPIVFSKKFARRMTEMASKKTVMERFKVFSGFRPGELVPQPPQTSEPRTGLSMGQH
CELMAKKWEIPRVEQDELAYESHKHAAEAYVSGYMDDLVVPCAGVFRDNNIREDISLDKL
ATLKTAFDKSDTATLTAANSTPLTDGAAAVLLASEEWAAERGLPIQAYLVDAQHIGNDFV
SGEGLLMAPTIAVSKLLDRNGLTLQDFDFYEIHEAFAAQVLATLKAWEDPEYCKNVLGKD
APLGSIDRTKLNVKGSSIAVGHPFAATGARIMANLAKLLDQNGGRGLISVCTAGGMGVAA
ILESPKAKAMDVAA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaacgctacgccgagtcgccatcatcggcggcgtcagaattccgttctgtcgt
tcggggacgctgtacgctgatctgtccaacctcgacatgatgacagcagctctttccggc
ctcgtcgatcgattcaatctgaaaggggcccatgtcgacgaagtcgtcggcggggccgtt
gtcacgcatgccaaggattggaacctggcccgtgaagcggtgctgagcacgaccctcgcg
ccatccacaccgggcatcaccatgatgcaggcatgcggcacaagcctgcaggcggcaatg
gggatagccgccaagattgcggcaggtcagatcgagagcggcattgctgtgggatcagat
acaacctcagatccgcctatcgtcttcagcaagaagtttgcgcgccgtatgaccgagatg
gccagcaagaagacggtcatggagcgctttaaggtgtttagcggctttcggcctggtgaa
ctcgtaccgcagccgccgcaaaccagcgagccacggacgggcctttcaatgggtcagcac
tgcgaacttatggccaagaagtgggagatccctcgggtcgagcaggatgagctggcctac
gaaagccacaagcacgcagccgaagcctatgtgtctggttatatggacgatttggtcgtg
ccctgcgccggcgtttttcgcgacaacaacattcgagaagatatcagcctcgataagctc
gcgactctgaaaaccgctttcgacaaatccgacaccgcaacgttgacagcagccaactcc
acccccctgaccgatggagcagcagctgtgctcctcgcatcggaagaatgggcggctgaa
cgcggcttgccaatccaagcttatctcgtcgacgcgcaacacatcggtaatgacttcgta
tccggcgaaggtcttctcatggcgccaacgatcgcggtgtccaagctgcttgatcgtaac
ggcctcacgcttcaggacttcgacttctacgagatccatgaagccttcgcggcccaggtt
ctcgccacactcaaagcctgggaagatccggaatattgtaaaaacgtacttggcaaagat
gcacctctagggtccatcgatcgcaccaagctcaacgtcaaaggctcatccatcgccgtg
gggcacccctttgccgcgaccggggcacgtatcatggccaacctcgccaagctgctcgat
cagaatggcggccgcggattgatctcggtttgcacagccggaggtatgggcgtggcggcg
attctggaaagccccaaagcgaaggcgatggacgtagcagcctga

DBGET integrated database retrieval system