KEGG   Flavobacterium indicum: KQS_05630Help
Entry
KQS_05630         CDS       T01781                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
fin  Flavobacterium indicum
Pathway
fin00020  Citrate cycle (TCA cycle)
fin00640  Propanoate metabolism
fin00660  C5-Branched dibasic acid metabolism
fin01100  Metabolic pathways
fin01110  Biosynthesis of secondary metabolites
fin01120  Microbial metabolism in diverse environments
fin01130  Biosynthesis of antibiotics
fin01200  Carbon metabolism
Module
fin_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fin_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fin00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KQS_05630 (sucC)
   00640 Propanoate metabolism
    KQS_05630 (sucC)
   00660 C5-Branched dibasic acid metabolism
    KQS_05630 (sucC)
Enzymes [BR:fin01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     KQS_05630 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: CCG53091
UniProt: H8XVC1
Position
1242512..1243705
Genome map
AA seq 397 aa AA seqDB search
MNLHEYQGKSILASYGVRVQRGHVANNAEEAVEKAKQLTAETGTGWHVIKAQIHAGGRGK
GGGVKLAKNLDQVREIAGQIIGMDLITPQTPPTGKRVHKVLVAEDVYYPGESETKEFYMS
VLLNRGTGRNMIMYSTEGGMDIEEVAEHTPDKIFTEEIDPAYGLQGFQARRIAFNLGLSG
EAFKEMTKFVDALYKAYIGSDSSMFEINPVLKTSDNKIMAVDAKVTLDDNALYRHADLAE
MRDITEERPIEVEAKEAGLNYVDLDGTVGCMVNGAGLAMATMDLIKYAGFEPANFLDVGG
TADAKRVETAFRIILKDPNVKAILINIFGGIVRCDRVAQGVVDAYKNMGDAIKVPIIVRL
QGTNAEVAKELIDNSGMPILSAVQFQEAADQVKAALS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacacgaatatcaaggtaaaagtatattagctagctatggagtacgtgtgcaa
cgtggtcatgtagcaaacaatgctgaagaagcagttgaaaaggctaaacaattaactgct
gaaactggtacaggttggcatgtaatcaaagcacaaattcacgcaggtggaagaggaaaa
ggtggtggagttaagttagcaaaaaacttagaccaagttagagaaattgctggacaaatt
attggaatggatttgattacacctcaaacacctccaactggtaaaagagtacacaaagtg
ttagttgctgaagatgtatactatccaggagaatctgaaacaaaagagttctatatgtct
gttttattaaacagaggaacaggtcgtaatatgattatgtattctactgaaggtggaatg
gatattgaagaagtggcagaacatactccagataaaatttttactgaagaaattgatcca
gcttatggattacaaggtttccaagctagaagaattgctttcaacttaggtttatctggt
gaagcttttaaagaaatgacaaaatttgttgatgctttatacaaagcttatattggttct
gattcttcaatgtttgaaattaatccagtattaaaaacttcagataataaaattatggct
gttgatgctaaagttactttagacgacaacgctttataccgtcatgctgacttagctgaa
atgcgtgatattacagaagaaagaccaattgaagtagaagctaaagaagctggattaaat
tatgttgatttagatggtactgtaggttgtatggttaatggtgctggtttagcaatggct
acgatggacttaattaaatatgcaggttttgaaccagcaaacttcttagacgtaggagga
acagcagatgcaaaacgtgttgaaacagcattccgtatcattttaaaagatccaaatgta
aaagcaattttaattaacatctttggtggtattgttcgttgtgaccgtgttgcacaaggt
gttgttgatgcttataaaaatatgggtgatgcaattaaagtgccaatcattgttcgttta
caaggaacaaatgctgaggtagcaaaagaattaattgataattcaggtatgccaatttta
tctgcggttcaattccaagaagcagcagatcaagtaaaagcagctttatcttaa

DBGET integrated database retrieval system