KEGG   Flavobacterium indicum: KQS_10995Help
Entry
KQS_10995         CDS       T01781                                 

Gene name
phhA
Definition
(GenBank) Phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
fin  Flavobacterium indicum
Pathway
fin00360  Phenylalanine metabolism
fin00400  Phenylalanine, tyrosine and tryptophan biosynthesis
fin00790  Folate biosynthesis
fin01100  Metabolic pathways
fin01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fin00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    KQS_10995 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KQS_10995 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KQS_10995 (phhA)
Enzymes [BR:fin01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     KQS_10995 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H ARA70 cwf18
Motif
Other DBs
NCBI-ProteinID: CCG54121
UniProt: H8XPQ5
Position
2349352..2351106
Genome map
AA seq 584 aa AA seqDB search
METHFESNPLIDRLPTHLKQFIKPQNYEDYTPINQAVWRYVMRKNVDYLGKVAHESYLEG
LHQTGIDIENIPNMYGMNRILKEIGWAAVAVDGFIPPNAFMEFQAYNVLVIACDIRQLEH
IEYTPAPDIIHEGAGHAPIIANPEYAEYLRRFGEIGCKAISSARDYELYEAIRLLSILKE
AENTPQEEIEKAEAQVDFLQKNMGELSEMSRIRNLHWWTVEYGLIGTVENPKIYGAGLLS
SIGESAWCMTDNVKKIPYDIKAADVSFDITKPQPQLFVTSDFAHLNMVLEEFANKMALRT
GGLSGIKKLISSKALGTIELSTGLQISGIFTNVIEHEGKPVYIQTTGKTALSYREKELVG
HGTEYHAEGYGSPIGKLKGINLAIEDMSPRDLSAYDIYEGEQVTLEFEGGIKVSGEIITG
TRNIQGKILLIKFKNCTVTHEDTILFQPEWGIYDMAVGKDVISAFSGPADVNSFDMINHV
PSSQTIKQKKSIEREELEHLYKNVRNIRENKAAEITLKEAFGAVSSNHPNDWLLSVEILE
IAHKENNSDLVEKVQNHLEKLKIKRPEVAHLINNGIELIFPIMA
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggaaacacattttgaaagcaatccgttgatagacagattacctactcatttaaaacaa
ttcatcaaacctcaaaattacgaggactacacacctattaaccaagcagtttggagatat
gttatgcgtaaaaatgtagactatctaggtaaagtagcacatgaatcttatcttgaaggg
cttcatcaaacaggaattgacattgaaaatattccaaacatgtacggcatgaatcgaatt
cttaaagaaattggttgggccgctgtggcggttgatggctttattccaccaaatgctttt
atggaatttcaagcgtacaatgtattagttattgcttgtgacattcgtcaattagaacat
attgaatatactccagctccagatattatccacgaaggtgccggccacgctcctattata
gccaatcctgaatatgctgaatatttaagacgatttggtgaaataggatgcaaagcaata
tcttctgctcgtgattatgaattatatgaagctattcgattgttatctatattaaaagaa
gccgaaaatacgccacaagaagaaattgaaaaagcggaagcacaggttgattttctacaa
aaaaatatgggtgagttatctgaaatgtcaagaattagaaatttacattggtggacggta
gaatatggcttaattggaacggttgaaaatcctaaaatatatggcgctggtttgttgtca
tcaattggagaaagtgcttggtgtatgaccgacaatgttaaaaaaataccttatgacatt
aaagcagcagatgtaagctttgatattacaaaaccgcaacctcaattatttgtcacatcc
gattttgcacacttaaacatggtgcttgaggagtttgcaaataaaatggcgttacgaaca
ggtggtttatcaggaataaaaaaattaatttcttctaaagcacttggaaccatagaatta
agtacaggcttacaaatatcgggtatctttacaaatgttattgagcacgaaggcaaacct
gtatatattcaaacaacaggaaaaacagcattatcttatagagaaaaagaattagtagga
catggaacagaataccatgccgagggttacggctctccaattggcaaattaaaaggcatt
aatttagctattgaagatatgagtccgcgtgatttaagcgcttacgacatttatgaaggc
gaacaagttacgttagagtttgaaggtggaataaaagtttcgggagaaattataaccggt
acaagaaatattcaaggaaaaattttattgattaaatttaaaaattgtacagttactcat
gaggatactattttattccaaccagaatggggaatttacgatatggctgttggtaaagat
gttatctctgctttttctgggcctgctgatgtaaatagctttgatatgattaaccatgtt
ccatccagtcaaactattaaacaaaaaaaatcaattgaaagagaagaattagaacattta
tataaaaacgttagaaacattagagaaaacaaagctgctgaaataacattaaaagaagcg
tttggtgctgtttcttcaaatcaccctaatgattggttactaagtgttgaaattttagaa
attgcacataaagaaaacaatagtgatttagttgaaaaagttcaaaatcatttagaaaaa
ttaaaaattaaaagaccagaagttgctcatttaatcaacaatggcattgaactaattttc
cctattatggcttaa

DBGET integrated database retrieval system