KEGG   Flavobacterium indicum: KQS_11860Help
Entry
KQS_11860         CDS       T01781                                 

Gene name
pruA
Definition
(GenBank) 1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
fin  Flavobacterium indicum
Pathway
fin00250  Alanine, aspartate and glutamate metabolism
fin00330  Arginine and proline metabolism
fin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fin00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KQS_11860 (pruA)
   00330 Arginine and proline metabolism
    KQS_11860 (pruA)
Enzymes [BR:fin01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     KQS_11860 (pruA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh SGTA_dimer
Motif
Other DBs
NCBI-ProteinID: CCG54283
UniProt: H8XR49
Position
2526484..2528109
Genome map
AA seq 541 aa AA seqDB search
MPKGFFNVPKALNEPVKSYAPGTPEREQVLKAYKELWNTSIDVPLYIGKEQIKTGNTKTM
SAPHDHQHIVGTYHLAEKTHVEKAIAEALEARKAWASLPWEHRASIFLKAAELIAGPYRA
KINAATMIAQSKTVHQAEIDAACELIDFLRFNVEFMTQIYQDQPYSPSDVWNRVEYRPLE
GFVYAVTPFNFTAIAANLPASAAMMGNTVVWKPSDSQVFSAKVIIDIFKEAGLPDGVINV
VFGDPIMITDTVLASPDFAGIHYTGSTFVFKEIWAKIGANIHTYKTYPRIVGETGGKDFI
LAHPSADPIQVAANSIRGAFEFQGQKCSAASRAYFPKSLWPAIKAEFDKEIPTIKMGSPE
DLNNFFTAVIHEGSFDKLVSYIEQAKQDADAEIIFGGGYDKSKGWFVEPTIILTTNPKYK
TMETELFGPVLTIYIYEDAEWSSVLKLIDETSEYALTGAVFSEDRYAINEAAKALENAAG
NFYINDKPTGAVVGNQPFGGARASGTNDKAGSAQNLLRWVSPRTIKETFVTPVNYRYPFL
G
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaggattttttaacgtaccaaaagctcttaacgaacccgttaaaagttatgca
cccggtacgccagaaagagaacaagttttaaaagcgtataaagaattatggaatacttca
attgatgttcctttatacataggtaaagagcaaattaaaacaggaaacaccaaaacaatg
tctgctcctcatgaccaccaacatattgtaggaacttatcatttggctgaaaaaacgcat
gtagaaaaagctattgccgaagctttagaagctagaaaagcttgggcttcattaccatgg
gaacatcgagcatccatctttttaaaagcagctgaattaattgccggaccttaccgtgca
aaaatcaatgctgctaccatgattgcacaatcaaaaaccgtacatcaagcagaaattgat
gccgcttgtgagttaattgactttttacgtttcaatgtagaattcatgactcaaatctat
caagaccaaccttattctccttcagatgtttggaatcgagttgaatacagaccgttagaa
ggatttgtttatgctgttacgcctttcaattttactgcaattgcagcgaacttacctgct
tcagctgcaatgatgggtaatactgttgtttggaaaccaagcgacagccaagtattttct
gccaaagtgatcattgatattttcaaagaagctggattaccagacggtgtaatcaatgtt
gtttttggtgatccaatcatgattacagatactgttttagcaagtccagattttgctgga
attcactatactggttctacttttgtattcaaagaaatttgggctaaaattggcgcaaat
attcatacttataaaacctacccaagaattgttggagaaaccggtggaaaagatttcatc
ttagcacatccttctgctgaccctattcaagtagcagctaattcaattagaggtgcattt
gaattccaaggacaaaaatgttctgcagcatcaagagcttatttcccaaaaagtttatgg
cctgctattaaagctgaattcgataaagaaatcccaactattaaaatgggatctccagaa
gatttaaataatttctttacagccgtaattcatgaaggatcttttgacaaattagtttct
tacatcgaacaagccaaacaagatgctgatgctgaaattatttttggtggcggttacgac
aaatcaaaaggatggtttgtagaacctacaattatcttaactacaaatccaaaatataaa
acaatggaaacagaattgtttggtcctgttttaaccatttatatttatgaggatgcggag
tggagttctgttcttaaattaattgacgaaacttctgaatatgccttaactggagctgta
tttagtgaagatcgatatgccattaatgaagcggctaaagccttagaaaatgcagctggt
aacttctatatcaatgacaagcctactggcgctgtagttggtaatcaaccgtttggagga
gctagagcttctggtacaaacgacaaagcgggttctgctcaaaacttattgcgttgggta
tctccaagaacaattaaagaaacgttcgtaacacccgtaaattatagatatccgttttta
ggataa

DBGET integrated database retrieval system