KEGG   Fischerella sp. NIES-3754: FIS3754_00050Help
Entry
FIS3754_00050     CDS       T04195                                 

Definition
(GenBank) glucose 1-dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
fis  Fischerella sp. NIES-3754
Pathway
fis00030  Pentose phosphate pathway
fis01100  Metabolic pathways
fis01120  Microbial metabolism in diverse environments
fis01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fis00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    FIS3754_00050
Enzymes [BR:fis01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     FIS3754_00050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR THF_DHG_CYH_C Eno-Rase_NADH_b Epimerase 2-Hacid_dh_C Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: BAU04122
UniProt: A0A0S3TG78
Position
complement(4099..4908)
Genome map
AA seq 269 aa AA seqDB search
MKGLKGKNVLITGASSGIGQAIAIRLAQEGCNIAINYRKSPEGAEDTEEMAMQKACGGIE
NCGVKSLLVQGDVSKEEDIIKMVNSVVDKLGSLDILVNNAGIQTECPSHEVKTEDFDRVI
GVNLRGAYLCARETIKYFLSQNRSGIIINISSVHEIIPRPMYVSYSISKGGMENMTKTLA
LEYANRGIRVNAIAPGATITPINEAWTDDPQKKAVVESRIPMGRAGTSEEMAAAVAFLAS
DEAAYITGQTLFIDGGLTLYADFREAWSA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggattaaaaggtaaaaatgttttgattacaggcgcaagttctggtattggacaa
gcgatcgccattcgccttgcccaagaaggctgtaatattgccattaattaccgcaaaagt
cctgaaggtgcggaagataccgaagaaatggcaatgcaaaaagcctgtgggggtattgaa
aattgcggtgtgaagtcacttctagtacaaggcgacgtctctaaggaagaagacattatt
aaaatggtcaacagcgtagttgacaagttgggtagccttgatattttggtcaataatgcc
ggaattcaaaccgaatgtccatctcatgaagtgaagaccgaagactttgaccgagtgatt
ggggtgaatctgcggggtgcttatctgtgtgcgcgtgaaactatcaaatacttcctttcg
caaaaccgttccggaatcatcattaatatttctagcgttcacgaaattattccccgacca
atgtatgtcagttactccattagcaaaggcgggatggaaaatatgaccaaaactctggca
ctggagtatgcaaaccgaggtatccgagtcaacgcgatcgcgccgggagcaactatcacc
cctatcaatgaagcttggactgatgacccccaaaagaaagcagttgtagaaagtcgcata
cccatgggtcgtgcgggaacttcggaagagatggctgcagcagtagcttttttagcatct
gacgaagccgcatacatcacaggacaaacactgtttattgacggtgggctgacactatac
gctgacttccgggaagcttggtctgcgtga

DBGET integrated database retrieval system