KEGG   Fischerella sp. NIES-3754: FIS3754_09320Help
Entry
FIS3754_09320     CDS       T04195                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
fis  Fischerella sp. NIES-3754
Pathway
fis00430  Taurine and hypotaurine metabolism
fis00460  Cyanoamino acid metabolism
fis00480  Glutathione metabolism
fis01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fis00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    FIS3754_09320
   00460 Cyanoamino acid metabolism
    FIS3754_09320
   00480 Glutathione metabolism
    FIS3754_09320
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fis01002]
    FIS3754_09320
Enzymes [BR:fis01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     FIS3754_09320
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     FIS3754_09320
Peptidases and inhibitors [BR:fis01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   FIS3754_09320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: BAU05040
UniProt: A0A0S3TIV4
Position
complement(1024189..1026036)
Genome map
AA seq 615 aa AA seqDB search
MPKFRPHTQVLLFVYYLCFSASLFYNHKQVTASISLPLRTKKAMVVSTHPLASNAGLQIL
RKGGNAIDAAVATTFAISVVEPFSAGIGGGGFLLFRDAKTGEIKALDFRERAPLKATRNM
YLDAQGKVRPNLSINGHLAVATPGTVAGLYEVHQRYGKLPWAEVVKPAIALAKDGFILSP
QVTWRSITAYEDRKQAILTNPAARAIFTRNGELYQPGEKLVQRDLAKTLTAISQNPRSFY
TGNIARAIATDMAKNGGLVTLEDLKSYQPIWRTPVCGNFRQARICSMPPPSSGGVHLLEI
LNIIGSTDLKSLGWRHPDAIHLMVEAMKIAYADRSKLLGDPNFVKVPIQQLLSPAYAQLR
RAEITMNRARAATEVKPANIKLQQNLTPQPLLCRQKSRLISASNSLMITHNTQETFYKPR
YESTETSHLNVVDAQRNTVSLTFTVNLGFGAAVVADGTGIVLNNEMDDFAAAPGVPNAFG
LLGNEANAIAPCKTPLSSMTPTIVTENGRLRLAVGAPGGGTIITQVLQVILNVLEYNMDV
GAAVSVPRIHHQWLPDELRVEPFGLDALTLSELQRRGHKIKQTQPWGNINAIAVTSDGSL
EAAADPRGEGSARGY
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaattccgtccccacacacaggttttactttttgtatattacctgtgtttttct
gcatcacttttttacaaccacaaacaagtaactgccagcattagcttacccctacgcacc
aaaaaagctatggtggtgtctactcatcccctcgccagtaacgcagggttgcaaatctta
cgcaaaggtggtaacgcaattgatgcagctgtagcgacgacttttgctatttccgtggta
gaacctttttcggcgggaattggtggcggtggctttttgctatttcgcgatgccaaaaca
ggagaaattaaagctttagattttcgcgaacgcgccccactcaaagcaacgagaaatatg
tatttggatgcccaaggtaaagtgcgtccgaatctaagtataaatggtcacttagcagta
gcaacaccagggacggtggcaggactgtacgaagtacatcaacgttatggtaaactgcct
tgggcagaagttgtaaaacctgcgatcgctcttgccaaagatgggtttatcctgagtcct
caagtaacgtggcgttcgatcacagcctacgaagatcgcaagcaagcaattctcactaac
ccagcagcacgggcaattttcactcgcaacggggaattgtatcaaccaggagaaaaatta
gtacagcgtgacttggcaaaaactttaacagcaatctcccagaacccccgcagtttttac
actggaaatatcgcccgtgccatcgctactgacatggcaaaaaatggtggtttggtaact
ctagaagacttgaaatcctaccaacccatctggcgcactcctgtatgtggcaattttcgc
caagcaagaatttgctccatgccacctccttcctcaggaggtgtacatttattggaaatt
ttaaatattatcggttccactgatttaaaatctttaggatggcgtcaccccgatgccatc
cacctgatggtagaagcaatgaaaattgcttatgctgatcgttcaaaattgttaggcgat
cctaattttgtcaaagtacctatacaacaattactcagccctgcctatgcccaactgcgt
cgggctgaaattacaatgaatagagctagggctgcaactgaagtcaagcctgcgaatata
aaattacagcagaatcttactcctcaacctcttctgtgtaggcagaaatcgagactaatt
tctgcaagtaattctttgatgatcactcacaacacccaggaaacattctacaaaccccgc
tacgagtctacagaaaccagtcatcttaacgttgtagatgcacaacgcaacaccgtaagt
ctaacttttactgttaacttgggatttggcgctgctgtggttgctgatggaacgggaatt
gtacttaataacgaaatggatgattttgccgctgcaccgggagtaccgaatgcttttggt
ttactgggtaacgaagctaacgcgatcgccccatgcaaaacacctttatctagcatgact
ccgacgattgtaactgaaaatggccgcctacgtttagcggtgggtgcgcctggtggtggt
actattattacccaagtactgcaagtcattctaaatgtgctggaatacaacatggatgta
ggcgcagccgtttctgttcctcgcatccatcatcagtggcttcccgatgaattgcgagtc
gaaccctttggtttggatgctctcactttgtcagaattacagcgtcggggacacaaaatt
aaacaaacccagccttggggtaatattaacgcgatcgcagttacgtctgatggaagttta
gaagcagcagccgatccacgtggtgaaggatcagcaagaggatattaa

DBGET integrated database retrieval system