KEGG   Fischerella sp. NIES-3754: FIS3754_44500Help
Entry
FIS3754_44500     CDS       T04195                                 

Definition
(GenBank) photosystem q(b) protein
  KO
K02703  photosystem II P680 reaction center D1 protein [EC:1.10.3.9]
Organism
fis  Fischerella sp. NIES-3754
Pathway
fis00195  Photosynthesis
fis01100  Metabolic pathways
Module
fis_M00161  Photosystem II
fis_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:fis00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    FIS3754_44500
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:fis00194]
    FIS3754_44500
Enzymes [BR:fis01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.9  photosystem II
     FIS3754_44500
Photosynthesis proteins [BR:fis00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Main subunits
    FIS3754_44500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Photo_RC
Motif
Other DBs
NCBI-ProteinID: BAU08502
UniProt: A0A0S3TU10
Position
5106316..5107398
Genome map
AA seq 360 aa AA seqDB search
MTTTLTRGESGSLWDRFCEWITSTNNRLYIGWFGVLMIPTLLTATICFIIAFIAAPPVDI
DGIREPVSGSLLYGNNIITGAIVPTSNAIGLHFYPIWEASSLDEWLYNGGPYELIVFHFL
IGIFCWMGRQWELSYRLGMRPWICVAYSAPVAAATSVFLIYPIGQGSFSDGMPLGISGTF
NFMLVFQAEHNILMHPFHQLGVAGVFGGSLFCAMHGSLVTSSLVRETTENESVNYGYKFG
QEQETYNIVAAHGYFGRLIWQYASFNNSRSLHFFLAAWPVVCIWFTALGISTMAFNLNGF
NFNQSILDSHGRIVNTWADILNRANLGMEVMHERNAHNFPLDLASGEAVPVAMNAPAIHG
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaactttaacaagaggcgaaagtggtagtctctgggataggttctgtgagtgg
attaccagcaccaataatagactttacattggctggttcggcgttttaatgattccaacg
ctgttgacagcaactatctgttttattattgccttcattgccgcaccaccagtcgatatt
gacggtattcgtgaacctgtttccggttctttgttatatggcaacaacataattactggt
gccattgtacctacatctaatgcgattggcttgcacttttacccgatttgggaagcatct
tctcttgatgaatggctctataacggtggtccctacgagctaattgttttccatttcctc
atcggtattttttgctggatgggacgacaatgggaactcagctatcgcttgggtatgcgt
ccttggatctgcgttgcttattctgctcccgtagctgctgctacctctgtctttttaatt
tatcctattgggcaaggcagtttctctgatggaatgcctttaggcatcagtggtacattt
aatttcatgcttgtgttccaagcggaacataacattctcatgcatcccttccatcaactt
ggtgtggctggggtgtttggtggttcgcttttctgtgcgatgcacggctctttggtgact
tcctccttggtaagggaaaccacagagaatgaatccgttaactatggatataaatttgga
caagagcaggaaacctacaatatcgtggctgctcatggttacttcggacgcttaatttgg
caatacgccagctttaacaactctcgttctttgcactttttcttagcagcttggcccgta
gtttgtatttggttcacggctttgggtatcagcacaatggcgtttaacttgaatgggttt
aactttaaccaatcaattcttgactctcacggtcgcatagttaacacctgggcagatata
ctcaaccgtgctaacctgggcatggaagtgatgcacgagcgtaatgctcacaacttccca
ttagacttggcaagtggtgaagctgtacctgtagcgatgaacgctcctgcaattcatgga
tag

DBGET integrated database retrieval system