KEGG   Fischerella sp. NIES-3754: FIS3754_49070Help
Entry
FIS3754_49070     CDS       T04195                                 

Definition
(GenBank) light-independent protochlorophyllide reductase subunit N
  KO
K04038  light-independent protochlorophyllide reductase subunit N [EC:1.3.7.7]
Organism
fis  Fischerella sp. NIES-3754
Pathway
fis00860  Porphyrin and chlorophyll metabolism
fis01100  Metabolic pathways
fis01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fis00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FIS3754_49070
Enzymes [BR:fis01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     FIS3754_49070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: BAU08948
UniProt: A0A0S3TV63
Position
complement(5686699..5688099)
Genome map
AA seq 466 aa AA seqDB search
MTLAQPEALNFECETGNYHTFCPISCVAWLYQKIEDSFFLVIGTKTCGYFLQNAMGVMIF
AEPRYAMAELEEGDISAQLNDYEELKRLCLQIKRDRNPSVIVWIGTCTTEIIKMDLEGLA
PKLEAEIGIPIVVARANGLDYAFTQGEDTVLAAMATRCPDKAPVVEAEKNERNAIQKLLN
FGKKKEEVAQEESEYVNHPPLVLFGSLPDPVVTQLTLELKKQGIKVSGWLPAKRFTELPV
IEEGYYVAGVNPFLSRTATTLMRRRKCKLIGAPFPIGPDGTRAWIEKICSVFGITPQGLD
EREAQIWKGLEEYIKLIRGKSVFFMGDNLLEVSLARFLVRCGMTVHEIGIPYMDKRYQAA
ELALLEKTCKEMGVPMPKIVEKPDNYNQVQRIYQLQPDLVITGMAHANPLEARGINTKWS
VEFTFAQIHGFTNARDILELVTRPLRRNNSLKDLGWDKLVKEEAKI
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgactcttgctcaaccagaagctttaaattttgagtgtgaaactggaaattaccatacc
ttttgccctattagctgtgtagcttggttataccaaaaaattgaagatagcttctttttg
gtaattggtacaaaaacttgtggctacttcctgcaaaatgcgatgggggtaatgattttt
gcagaaccccgttacgcaatggcagagttagaagaaggcgatatttcggcccaactgaat
gattatgaggaattgaagcgcttgtgcttgcagatcaaacgcgatcgcaatcccagcgta
attgtctggatcggcacttgcactaccgaaatcatcaaaatggatttagaaggcttggcc
cccaagctggaagccgaaatcggtatccccattgttgtcgcccgtgctaacggtttagac
tacgctttcacccaaggagaagacacagtcttagctgcaatggctacacgttgtccagat
aaagctcctgtggtagaagcagagaaaaacgagcgcaacgctattcaaaagctactcaac
tttggtaagaagaaagaagaagttgcccaagaagagtctgagtacgtaaatcatcccccg
ctagtactatttggttcactccccgatcccgtagttactcagctgactctagaactgaaa
aagcaaggtattaaagtttctggctggctacctgccaagcgttttacagaactgcctgta
attgaagaagggtattatgttgctggtgtcaaccccttcctcagccgtaccgctacaact
ctcatgcggcgtcgcaaatgcaagctcatcggcgcacccttccccatcggtccagatgga
actcgtgcttggattgagaaaatttgctcggtttttggtattaccccccaaggtttagac
gaacgagaagcccaaatttggaaaggtttggaagaatacatcaaactaattcgtggcaag
tctgtattcttcatgggtgacaatttgttggaagtttccctcgcccgcttcttggtacgc
tgcggtatgactgtgcatgaaataggcattccctatatggacaagcgctaccaagctgct
gaattagccttgctggagaagacttgcaaggaaatgggtgtacctatgcctaagattgtg
gagaaaccagacaactataatcaagtccaacgcatttaccagttgcagcctgacttagta
attactggtatggctcacgccaaccccttagaagcacgtggaattaacaccaagtggtct
gtagaatttacatttgctcaaattcacggttttaccaacgcccgtgacatccttgagtta
gtcactcgtcccctacgtcgcaataacagcctcaaagatttaggttgggacaaattggtg
aaggaagaagccaaaatttaa

DBGET integrated database retrieval system