KEGG   Candidatus Filomicrobium marinum Y: BN1229_v1_1536Help
Entry
BN1229_v1_1536    CDS       T03857                                 

Gene name
yqeF
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
fiy  Candidatus Filomicrobium marinum Y
Pathway
fiy00071  Fatty acid degradation
fiy00072  Synthesis and degradation of ketone bodies
fiy00280  Valine, leucine and isoleucine degradation
fiy00310  Lysine degradation
fiy00362  Benzoate degradation
fiy00380  Tryptophan metabolism
fiy00620  Pyruvate metabolism
fiy00630  Glyoxylate and dicarboxylate metabolism
fiy00640  Propanoate metabolism
fiy00650  Butanoate metabolism
fiy00900  Terpenoid backbone biosynthesis
fiy01100  Metabolic pathways
fiy01110  Biosynthesis of secondary metabolites
fiy01120  Microbial metabolism in diverse environments
fiy01130  Biosynthesis of antibiotics
fiy01200  Carbon metabolism
fiy01212  Fatty acid metabolism
fiy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:fiy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN1229_v1_1536 (yqeF)
   00630 Glyoxylate and dicarboxylate metabolism
    BN1229_v1_1536 (yqeF)
   00640 Propanoate metabolism
    BN1229_v1_1536 (yqeF)
   00650 Butanoate metabolism
    BN1229_v1_1536 (yqeF)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BN1229_v1_1536 (yqeF)
   00072 Synthesis and degradation of ketone bodies
    BN1229_v1_1536 (yqeF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN1229_v1_1536 (yqeF)
   00310 Lysine degradation
    BN1229_v1_1536 (yqeF)
   00380 Tryptophan metabolism
    BN1229_v1_1536 (yqeF)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN1229_v1_1536 (yqeF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN1229_v1_1536 (yqeF)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN1229_v1_1536 (yqeF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fiy04147]
    BN1229_v1_1536 (yqeF)
Enzymes [BR:fiy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN1229_v1_1536 (yqeF)
Exosome [BR:fiy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN1229_v1_1536 (yqeF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CPR18052
UniProt: A0A0D6JDP4
Position
1:1465407..1466597
Genome map
AA seq 396 aa AA seqDB search
MSQDNETIVIASAARTPVGSFNGSLAAVPAHELGKVAITAALERAGVQPNEVSEVILGQV
LTAGAGQNPARQASIAAGLPIETTAWGMNQVCGSGLRAVALGAQQIMTGSASIVVAGGQE
NMSMSPHCMHLRDGVKMGDAKMIDTMIRDGLWDAFNGYHMGTTAENVARQFQITREEQDA
FAAASQNKAEAARKAGKFKDEIAPVTVKTRKAEVVVDQDEYIKEGVTAESIAKLRPAFDP
KEGTVTAANASGINDGAAVALLMTAAEAKRRGLTPLARIVSWATAGVDPSVMGTGPIPAA
KKALEKAGWSADDLDLIEANEAFAAQACAVNKGLGWDLSKVNVNGGAIAIGHPIGASGCR
ILNTLLFEMRRRDARKGLATLCIGGGMGIALCVARD
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagataatgagacgatcgtaattgctagcgcggcacgcacgcccgtcggttcg
ttcaatggctcgttagcggcggttccagcccacgaactcggaaaagtcgccattacggcg
gcgttggagcgggctggcgttcaacccaacgaggtctccgaggttattctcggtcaggtt
ttgacggccggtgccggtcaaaatccagcccgtcaggcgtccatcgcggcgggtctcccg
attgaaacaaccgcttggggtatgaaccaggtctgcggctccggtctgcgcgccgtggcg
ctcggcgctcagcagatcatgactgggtcggcttccattgttgtcgccggtggccaggaa
aacatgagcatgtcgccccactgcatgcatctgcgcgacggtgtgaagatgggcgacgcc
aagatgatcgacaccatgatccgcgatggcctgtgggacgcctttaacggctatcacatg
ggaacgaccgctgaaaacgttgcccgccagtttcagattactcgcgaagagcaagacgcc
ttcgcagctgcgtctcagaacaaggcggaagcagcccgcaaagccggtaagttcaaggat
gaaattgcaccggtgacggtcaagacgcgcaaggccgaggtggtcgtcgatcaggacgag
tacatcaaggaaggcgtcactgcggaatcgattgcgaagctgcgtccggcttttgatcct
aaggaaggcaccgtaacggccgctaacgcatccggcatcaacgacggtgcggcggttgca
ctgctgatgacggcggctgaagccaagcgtcgtggcttgaccccattggcgcgcatcgtg
tcatgggcaacggccggcgtcgatccgtccgtcatgggtaccggcccgatcccagcagcc
aagaaagcactcgaaaaggctggctggtcagcggatgacctcgatcttattgaggccaat
gaagccttcgcggcgcaggcttgcgcggtcaacaagggactcggctgggacctttccaag
gtcaacgtcaacggcggcgctattgctatcggccatcccatcggagcttcgggctgccgc
attctcaatacgctgctgttcgaaatgcgtcgtcgtgatgcgcgcaaaggcctggcaacc
ctgtgcatcggtggcggtatgggcatcgctctttgcgtcgcccgcgattga

DBGET integrated database retrieval system