KEGG   Candidatus Filomicrobium marinum Y: BN1229_v1_2184Help
Entry
BN1229_v1_2184    CDS       T03857                                 

Gene name
pdhB
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
fiy  Candidatus Filomicrobium marinum Y
Pathway
fiy00010  Glycolysis / Gluconeogenesis
fiy00020  Citrate cycle (TCA cycle)
fiy00620  Pyruvate metabolism
fiy01100  Metabolic pathways
fiy01110  Biosynthesis of secondary metabolites
fiy01120  Microbial metabolism in diverse environments
fiy01130  Biosynthesis of antibiotics
fiy01200  Carbon metabolism
Module
fiy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fiy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN1229_v1_2184 (pdhB)
   00020 Citrate cycle (TCA cycle)
    BN1229_v1_2184 (pdhB)
   00620 Pyruvate metabolism
    BN1229_v1_2184 (pdhB)
Enzymes [BR:fiy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BN1229_v1_2184 (pdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23
Motif
Other DBs
NCBI-ProteinID: CPR19476
UniProt: A0A0D6JFQ7
Position
1:2115472..2116782
Genome map
AA seq 436 aa AA seqDB search
MKGQQPVSLIDVKVPDIGDFQDIPVIEVLVKPGDEVSPEDPLVTLESDKATMEVPSPAAG
KVVEVLVNIGDKVSEGSAIIKLESAADVASAGGKAPKQSAAPPPPAPEVVTPPASQKTEP
STPPPSGGASSSGLPPPMDFGGVHASPSVRRLARELGVDLTQLKGTGEKGRVTKDDVKRA
LAGAPDAGMSGRGIPDIPAQDFSKYGEIETIPLTRLRKLSGPALHRAWLNIPHVTHTDEA
DITDLENYRKTIDAAAKEKGYRVTLLAFLMKAAVVALKAYPTFNASLSPTKDSLILKKYY
HLGIAVDTPDGLVVPVIKDVDRKGIMELSQELSEVSARMRDGKITPADIQGATFSISSLG
GIGGTNFTPIVNAPEVAILGVVRAAMKPVWDGAEFKPRLMLPLCVSYDHRVIDGALAARF
TRKFADVLADVRQLVL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggccagcagccagtgtccctgattgatgtaaaggtcccagacattggtgacttc
caagacattccagtgatcgaagttttggtgaaaccaggtgacgaggtttcgccggaagac
ccgctcgtaacgctggaaagcgacaaggcgacgatggaagtcccctctcccgcagcaggc
aaagtcgtcgaagttcttgtaaacatcggcgacaaggtcagcgaaggcagcgccattatc
aagctggagtcggcagctgatgtcgcaagtgcgggcggcaaggcacccaagcagagcgct
gccccccctccacctgcgcctgaggtggtcacaccgcccgcttcgcagaaaactgaaccg
tccacaccgcccccatccggcggcgcctcttcgagcggactgccaccaccgatggacttc
ggcggagttcatgcaagcccgtcggtccgtcggctggctcgtgagcttggtgtcgacctg
acccaactgaagggcacaggcgaaaaaggccgggtaacgaaggacgacgtcaaacgggcg
ctggcgggtgcaccggatgcgggtatgtccggccgcggtattcccgatattccggctcag
gatttctccaaatacggagagatcgaaaccatccccctgacacgcctgcggaagctttcc
ggacccgcactgcatcgcgcttggctcaacattccgcacgtcacgcatacagatgaagcg
gacatcactgatctcgaaaactaccgtaagacgattgacgcggctgccaaggagaaaggc
taccgcgttaccttgctcgccttcctcatgaaggcggcggtcgtcgcgcttaaggcgtat
ccgacgttcaatgcgtctctgagcccgaccaaagactccttgatccttaagaaatactac
cacttgggcatcgcggtcgatacgccggacggcctcgttgtgcctgtgatcaaggacgtt
gatcgcaaaggcatcatggagttgtcgcaggagctgagcgaagtctccgcccgcatgcgc
gacggcaagataacgcctgcggacatccagggcgcaacgttctcgatttcgagtttaggc
ggtatcggcggcacgaatttcacgccgatcgtcaacgcaccggaagtggcaatcctcggt
gttgttcgcgcggcgatgaagcccgtttgggatggggccgaatttaagccgcgcctgatg
ttgccgctctgcgtgtcctacgaccatcgcgttatcgacggggccttggccgcgcgcttc
accagaaaatttgcggacgtacttgccgatgtccgtcagctcgttctctga

DBGET integrated database retrieval system