KEGG   Candidatus Filomicrobium marinum Y: BN1229_v1_2362Help
Entry
BN1229_v1_2362    CDS       T03857                                 

Definition
(GenBank) putative Aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
fiy  Candidatus Filomicrobium marinum Y
Pathway
fiy00260  Glycine, serine and threonine metabolism
fiy00630  Glyoxylate and dicarboxylate metabolism
fiy00670  One carbon pool by folate
fiy01100  Metabolic pathways
fiy01110  Biosynthesis of secondary metabolites
fiy01130  Biosynthesis of antibiotics
fiy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fiy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BN1229_v1_2362
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BN1229_v1_2362
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BN1229_v1_2362
Enzymes [BR:fiy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     BN1229_v1_2362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T SoxG GCV_T_C
Motif
Other DBs
NCBI-ProteinID: CPR19881
UniProt: A0A0D6JG16
Position
1:2292618..2293613
Genome map
AA seq 331 aa AA seqDB search
MSFSLTDLARDYGDIIGEAAVCRKSAAVFDFSFMSRVRVAGPYALAAVQTLTQRNLSDLS
VGRLRYCLRQTSSGHVAVDLTIWRVGTDTFEVMSGRHQDIANLLALAPAATDLSDACVIY
ALQGPNSLDVLSEFADRAALAELPYFGCTEIHVIGVPCLVGRLGYTGEAGFEIIAPKQSA
TELWNALTKRVPPAGFAAADILRIEAGFILFANELSLPVKAHELGLATFSGEAEVRENVP
ISLVAFTAEADTRPVLWQPHAEVRRPQRPGEITVTSACWSPLVGAILGLGYACTTDEGAS
LRDENGVFHEIRRIERPYYDPQKLRPRAPWR
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcagtctcacagatttggcccgagactatggtgacattattggggaagctgcc
gtatgccgaaagagcgcggcagtttttgacttctcgttcatgtcccgagtccgagtcgcc
ggaccgtatgcgctcgctgcagtacagacactgacgcagcgcaatttatccgatttgtcc
gtcggtcggttgcgttactgcctgcgccagacatcgtcgggacacgttgcagtcgatctc
accatatggcgcgtcgggaccgacacattcgaggtgatgagcggtcggcatcaggatatc
gccaatctgctcgcattggccccagcagccacggatctcagcgacgcgtgcgttatctac
gcccttcaggggcccaatagcctggacgtactcagcgagtttgctgatagagcggcgctc
gccgagcttccctactttggctgtactgagatccacgtcataggggtgccatgcctcgtc
gggcgcctgggctataccggggaagctggcttcgagatcattgcgccgaagcagagcgcc
acagagttatggaacgcactgacgaagcgtgtgccccctgccggctttgcagccgctgat
attttgcgcatagaggccggattcatcttattcgccaacgaactaagcctgcccgtaaaa
gctcacgaattgggacttgccacattctcaggtgaggctgaggtgcgggaaaacgttccc
atatcattggtggcctttacggccgaggccgacacaagacctgttctctggcaaccacac
gccgaagtgaggagaccccaacgcccaggagaaatcactgtgacctcggcatgctggagt
cctttagtgggtgcgattctcgggttgggatatgcgtgcacgaccgacgagggggcctct
ttgcgagacgagaatggcgtatttcacgaaattcggcggatagagcggccctattatgac
ccccaaaaacttcgtccacgagcgccatggcgttga

DBGET integrated database retrieval system