KEGG   Candidatus Filomicrobium marinum Y: BN1229_v1_2448Help
Entry
BN1229_v1_2448    CDS       T03857                                 

Gene name
ompR
Definition
(GenBank) DNA-binding response regulator in two-component regulatory system with EnvZ
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
fiy  Candidatus Filomicrobium marinum Y
Pathway
fiy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:fiy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN1229_v1_2448 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:fiy02022]
    BN1229_v1_2448 (ompR)
Two-component system [BR:fiy02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   BN1229_v1_2448 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: CPR20083
UniProt: A0A0D6JHA6
Position
1:complement(2382361..2383077)
Genome map
AA seq 238 aa AA seqDB search
MGNPMRPIGDETLPDDAPHVLVIDDDQRIRDLLARYLYENGFRVTTSKDAEAAKAAMRGL
SFDLVLVDWMMPGQSGLDLARELKATKDIPICMLTAQSDPDHRITGLEAGVDDYIPKPFE
PRELLLRLRNIIRRGHAPGVPGDEVRMGAYVFHVGRGELKRDDESIKITERERELLRQFA
SRPGVPIPRHELSNDDSTGNERAIDVQINRLRRKIENDPSNPVYLQTVRGKGYILYTD
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggggaacccaatgagaccaatcggtgacgagacgttgccggacgatgcgccgcatgtg
ttggttatcgacgatgatcagcgcattcgggatcttttggcgcgctacctttacgagaat
ggcttccgcgtcacgacgtccaaagacgccgaagcggcgaaagccgccatgcgtggccta
tccttcgacctggtccttgttgactggatgatgccgggccaaagcgggcttgaccttgcc
cgtgaattaaaggcgacgaaggacattccgatttgcatgctcacggcccagtccgatccc
gaccaccggattacaggactagaggccggcgtcgacgattacatccccaaacccttcgaa
ccgcgtgagttgctgctacgtctgcgcaacatcattcgccgcgggcatgctcccggcgtg
ccgggggatgaagtccggatgggggcgtatgtgttccacgttggacgtggagaactcaaa
cgcgacgatgagagcatcaagatcaccgagcgcgaacgcgagttgctgagacagtttgcg
agccgtccgggtgttcctatcccccgacacgagctatcgaacgacgactcgacgggcaac
gagcgggctatcgacgtgcagatcaaccgtctgcgaagaaagattgaaaacgacccctcc
aacccagtctatttgcagacggtacgcggcaaggggtatatcctctacaccgactaa

DBGET integrated database retrieval system