KEGG   Candidatus Filomicrobium marinum Y: BN1229_v1_3916Help
Entry
BN1229_v1_3916    CDS       T03857                                 

Gene name
ndk
Definition
(GenBank) multifunctional nucleoside diphosphate kinase and apyrimidinic endonuclease and 3'-phosphodiesterase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
fiy  Candidatus Filomicrobium marinum Y
Pathway
fiy00230  Purine metabolism
fiy00240  Pyrimidine metabolism
fiy01100  Metabolic pathways
fiy01110  Biosynthesis of secondary metabolites
fiy01130  Biosynthesis of antibiotics
Module
fiy_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
fiy_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
fiy_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:fiy00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BN1229_v1_3916 (ndk)
   00240 Pyrimidine metabolism
    BN1229_v1_3916 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fiy04131]
    BN1229_v1_3916 (ndk)
Enzymes [BR:fiy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     BN1229_v1_3916 (ndk)
Membrane trafficking [BR:fiy04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    BN1229_v1_3916 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: CPR22483
UniProt: A0A0D6JKJ3
Position
1:3819886..3820308
Genome map
AA seq 140 aa AA seqDB search
MTIERTFSIIKPDATNRNITGAVNAVIEKAGLRIVAQKRVLWSREQAEKFYEEHAQRPFY
GELCDFMTSAPIVCQVLEGENAIAKYREVMGATDPAEAAEGTIRKLFALSKGENSVHGSD
SPTSAQREIALNFSDSEIVG
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgagcggaccttttccattatcaagccggatgcgacgaaccggaatatcacc
ggggctgtcaacgccgttattgagaaagctggcctgcgtatcgtcgcgcaaaagcgggtt
ctctggagccgcgagcaagctgagaagttctacgaggagcacgctcagcgcccattttac
ggtgaactctgtgactttatgacgtcggcaccaatcgtgtgccaagtgctcgagggcgaa
aatgcgatcgcgaagtatcgcgaggttatgggcgccacggacccagctgaagctgccgaa
ggtacgatccggaagctttttgctctttccaagggtgagaattcagtgcatgggtcagat
agtccgacatcggcacaacgcgaaatcgctctcaacttcagtgatagcgagattgtcgga
taa

DBGET integrated database retrieval system