KEGG   Flavobacterium anhuiense: BB050_01049Help
Entry
BB050_01049       CDS       T04718                                 

Gene name
xynC_2
Definition
(GenBank) Glucuronoxylanase XynC precursor
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
fjg  Flavobacterium anhuiense
Pathway
fjg00511  Other glycan degradation
fjg00600  Sphingolipid metabolism
fjg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fjg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    BB050_01049 (xynC_2)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BB050_01049 (xynC_2)
Enzymes [BR:fjg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     BB050_01049 (xynC_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_59 Glyco_hydro_30C Glyco_hydr_30_2 Lipase_GDSL_2
Motif
Other DBs
NCBI-ProteinID: AOC94184
Position
complement(1213327..1214787)
Genome map
AA seq 486 aa AA seqDB search
MKFNLKNTIKAFFVMAVVMSQVKCSSSSDPVENPPVVNPPVVVANDVDFWLTKGNQSALL
EKQTVKLGFGTTVNAYANIEVNAAQKYQTVDGFGYTLTGGSVDVINQLNATKRTALLQEL
FGNGENSIGVSYIRISIGASDLNATPFTYNDLATGETDLNLDKFSLEKDKNLIAMLKEIL
AINPKILILATPWSAPIWMKDVASFKGGKLKTEYYDIYAKYFAKYIQQMKAEGITIDAVT
PQNEPLHDGNNPSMYMSATDQANFIKNSLGPAFKTANLNVKIIAYDHNCDNPNYPKTILA
DAEAYPYVDGSAFHLYAGDITALLNVYNSYPAKNVYFTEQWTSSQGQFEGDLKWHLRNVI
IGSMRNYSKNALEWNLANNASFGPHTDGGCEMCKGAITITSGNSFERNVAYYIIAHASKF
VPMGSTRIESNSGGSLQNVAFITPSGSKVLIVENDGSATETFNIKFNGKWATTSLDAGSV
GTYTWK
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttaatttaaagaataccataaaagcgtttttcgtcatggcagtcgtcatgtct
caggttaaatgctcttcgtcaagtgatcctgtagaaaatccgcctgtggtaaatccgcca
gtagtagttgcaaatgatgttgatttctggttgacaaaaggaaatcaaagtgcattgtta
gagaaacaaacagtaaaattaggatttggcacaacagtgaatgcgtatgctaatattgaa
gtaaatgccgctcaaaaatatcagaccgttgatggtttcggatatactttgacaggagga
agcgtagacgttataaaccaattaaacgcaacaaaaagaactgctcttttacaagaatta
ttcgggaatggagaaaactcaattggagtaagttatatcagaatcagtattggagcttca
gatttaaatgcaacgccttttacttataatgatcttgcgacaggagaaacagatttaaat
ctagataaatttagtttagaaaaagataaaaatctaattgccatgctaaaagaaattctg
gcaattaatcctaaaattttaattttagcaacaccttggtctgcacctatttggatgaaa
gatgtcgcaagttttaaaggagggaaactgaaaacagaatattatgatatttacgctaaa
tattttgcaaaatacattcagcagatgaaagcagaagggattacaattgatgctgtaact
cctcaaaacgaacctttgcatgacggaaacaatccgagtatgtatatgtctgctacagat
caggccaattttattaaaaatagtttagggccggcttttaaaacagcaaatctaaacgtg
aaaatcattgcttacgatcacaattgcgataatccaaattatccaaaaaccattttagca
gatgcagaggcttatccttatgttgatggatctgcgttccatttatacgctggtgacatc
acagctttacttaatgtttacaattcgtatccagccaaaaatgtttattttacagagcaa
tggacttcatcacaagggcagtttgaaggcgatttaaaatggcatcttcgaaatgtaatt
atcggctcaatgagaaattacagtaaaaatgcattagagtggaatctagcaaataatgca
agttttggtcctcatacagatggaggatgtgaaatgtgtaaaggtgctataactataact
tcaggcaatagttttgaacgcaatgtagcgtattatataattgcacatgcttcaaaattt
gtcccaatgggatctactagaattgaaagcaattctggcggaagtttgcaaaatgttgct
tttatcacgccttctggttctaaagtcctgattgttgaaaatgatggttctgcaacagaa
actttcaacattaaatttaatggaaaatgggcaacaacttcgcttgatgcaggttcagtt
gggacttatacttggaaataa

DBGET integrated database retrieval system