KEGG   Flavobacterium anhuiense: BB050_04220Help
Entry
BB050_04220       CDS       T04718                                 

Gene name
mmgC_2
Definition
(GenBank) Acyl-CoA dehydrogenase
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
fjg  Flavobacterium anhuiense
Pathway
fjg00071  Fatty acid degradation
fjg00410  beta-Alanine metabolism
fjg00592  alpha-Linolenic acid metabolism
fjg00640  Propanoate metabolism
fjg01040  Biosynthesis of unsaturated fatty acids
fjg01100  Metabolic pathways
fjg01110  Biosynthesis of secondary metabolites
fjg01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:fjg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BB050_04220 (mmgC_2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BB050_04220 (mmgC_2)
   00592 alpha-Linolenic acid metabolism
    BB050_04220 (mmgC_2)
   01040 Biosynthesis of unsaturated fatty acids
    BB050_04220 (mmgC_2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BB050_04220 (mmgC_2)
Enzymes [BR:fjg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     BB050_04220 (mmgC_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N Pox_A31 Acyl-CoA_dh_2
Motif
Other DBs
NCBI-ProteinID: AOC97298
Position
complement(4956602..4958899)
Genome map
AA seq 765 aa AA seqDB search
MAKKTISKLNTIDMQNTKLQAFTPLFYLVWSDDLLTQKEFATLKEFINSLNVLSPDEKEY
LLSKADISNPPSRNELTQWKLDIEKSIQDTSSIKSIFDIAKALSGSNLDLTPIESDFKKL
ENDLGILGEEALQNFKTKAGSFTADSQTNASFDIQKITQILDGKEAAIIERVKSVISRPE
FAYETSTDINVFRQTVYKWCKILADENLGNMAYPKQYGGGENIADYFAIMETLSYHDLSL
VIKFGVQFGLWGMSVQSLGTEKHYAKYLKDIGSLKLPGCFAMTETHHGSNVKGLETTATY
NHSDQTFTIHTPNKNAQKEYIGNAAVHGQMATVFAKLIIDDHDYGVNAFVVPLRDPNGNV
VNGVTIGDCGHKMGLNGVDNGTISFDNVVIPKENMLDRFASVNDKGEFESPIPSDNRRFF
TMLGTLVGGRIGIPRSALAAAKSGLTIAIRYSDQRRQFGPEGGSEVPILNYRMHQRRLLP
HLAKTYAVHFALQYLTNRFLNRTEAEMQEIEALAAGMKSFSTWSTRDILQECREACGGKG
YLSENRIDALKNDTEIYTTFEGDNTVLMQLVAKNRLAEFRKAFGEMGSLGIINYVYENAK
TAIAEKNPIATRRTEDEHLLEGEFHLQAFVHREKTILASAARRIKKLIDGGLEPYDAFNV
VQHQMIDVAQAYLERIVLEQFQIAIKAVEDESSKAILTKLNQLYALSTIEKNKAWYLEDG
YMEAVKTKAVRKMVNQLCWDIRPDAVALVNAFDIPESCLAAPIAV
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaaaaaactatttctaaactgaatactattgatatgcaaaataccaaacttcaa
gcctttactccattattttatttagtgtggtcagatgatttactgacacagaaagaattt
gcaaccttaaaagagtttataaattccttaaatgttttgtctccagacgaaaaagaatat
ttgctttctaaagccgatatttcaaatccgccttcacggaatgaactcacacaatggaaa
ttggatattgaaaaaagtattcaggatacctcttcgatcaagtctatttttgatattgca
aaagcactttcaggaagtaatctagatttaactcctatagaatctgattttaaaaaatta
gaaaatgatttaggaattttgggagaagaagcattgcaaaatttcaagacgaaagcaggt
tcttttacagccgattctcaaactaatgccagttttgatattcagaaaatcactcaaatt
ttggatggaaaagaagcagcaataatcgaaagagtaaaatcggttatttcaagacctgaa
tttgcttacgaaacttctaccgatattaatgttttcagacagactgtctataaatggtgc
aagattctagccgatgaaaatctcggaaatatggcatatccaaaacaatatggaggagga
gaaaacatagcagattattttgcgattatggaaacgctgagttatcatgatttaagtctg
gtaattaaatttggtgttcaattcgggctttggggaatgagcgttcaatctttaggaacc
gaaaaacattatgctaaatatttaaaagatattggttcgctgaaacttcctggctgtttt
gctatgaccgaaacgcatcacggatctaatgtaaaaggtctggaaactacggcaacttat
aaccatagcgatcagacttttactattcatacgccaaacaaaaacgcccaaaaagaatat
attggcaacgcagccgttcacggacaaatggcaacagtttttgctaaacttattattgat
gatcatgattatggcgtaaatgcatttgtggttccattacgagatcctaatggaaatgtc
gtaaatggcgtgacaattggcgattgcggccataaaatgggattaaatggcgttgacaac
ggaaccattagttttgataatgtagtgattccgaaagaaaatatgctggatcgttttgct
tctgtgaatgataaaggagaatttgaaagtccaattccgagtgataaccgtagatttttt
acaatgttaggcactttggtaggagggagaattgggattccgcgttcggctttagcagca
gcaaaatctggattgacaattgccattcgctacagcgatcaaagaagacaattcgggcca
gagggtggatctgaggttccaattttaaattatagaatgcatcagcgtagattattgccg
catttagcgaaaacgtatgcagttcattttgcgctgcaatatttaacgaatagattttta
aatagaaccgaagccgaaatgcaagaaatcgaagctttggcggcgggaatgaaatctttt
tctacttggagcactagagatattttgcaggaatgcagagaagcctgcggaggaaaaggc
tatttgtctgaaaaccgaatcgacgcgcttaaaaacgacactgaaatctacactactttt
gaaggcgataataccgttttaatgcaattggtagctaaaaatcgtttggcagaattccga
aaggcgtttggagaaatgggatcgttgggaattattaattatgtctacgaaaatgcaaaa
acagctattgcagagaaaaacccaattgcaactcgaagaacagaagacgaacatttattg
gagggagagtttcatcttcaggcatttgtgcacagagaaaaaacaattttggcttcggca
gcgagacgtatcaagaaattaattgatggcggattagaaccttatgacgcctttaatgtg
gtgcagcatcaaatgattgatgtagcgcaggcgtatctagaaagaatagttttagaacaa
tttcagattgcaataaaagcggttgaagatgaatcatcaaaagcaattttgacaaaatta
aatcagttgtacgcgctttcaactatagaaaaaaataaagcttggtatctagaagacggc
tatatggaagcggttaaaacgaaagcagttcgtaaaatggtgaatcagctttgttgggat
attcgtccagatgctgtggctttggtaaatgcttttgatattcctgaaagctgtttagcg
gcgccaattgcggtctaa

DBGET integrated database retrieval system